SKU: 2492859392

Human CD8 alpha&beta (CD8A&CD8B) Heterodimer Protein, His Tag&Flag Tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 22 - Aug 27

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CD8 alpha&beta (CD8A&CD8B) Heterodimer Protein, His Tag&Flag TagProduct Specification Species Human Synonyms CD8 Amino Acid Sequence Protein sequence (P01732, Ser22 Asp182, with C Acidic Tail His tag) SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD Protein sequence (P10966, Asn19 Pro170, with C Basic Tail Flag tag)

Product Specification


Species Human
Synonyms CD8
Amino Acid Sequence

Protein sequence (P01732, Ser22-Asp182, with C-Acidic Tail-His tag) SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD Protein sequence (P10966, Asn19-Pro170, with C-Basic Tail-Flag tag) NSVLQQTPAYIKVQTNKMVMLSCEAKISLSNMRIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFILNLTSVKPEDSGIYFCMIVGSPELTFGKGTQLSVVDFLPTTAQPTKKSTLKKRVCRLPRPETQKGPLCSP

Expression System HEK293
Molecular Weight Predicted MW: 23.9 kDa(CD8A)&22.7 kDa(CD8B) Observed MW: 30, 35 kDa under reducing (R) condition, and 65-72 kDa under non-reducing (NR) condition
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

CD8 (cluster of differentiation 8) is a transmembrane glycoprotein expressed on cytotoxic T lymphocytes, serving as a coreceptor for the T cell receptor (TCR). It exists primarily as a CD8αβ heterodimer or a CD8αα homodimer, each chain belonging to the immunoglobulin superfamily. Functionally, its extracellular IgV-like domain binds the α3 domain of MHC class I molecules, stabilizing the TCR-antigen interaction. Concurrently, its cytoplasmic tail recruits the kinase Lck to initiate intracellular signaling cascades crucial for T cell activation and target cell killing. CD8 is thus essential for adaptive immunity against viruses and tumors.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 2492859392

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 30 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Alyssa Lynne
Pawtucket, US
★★★★★ 5
Necessity
After the disorganization of my working space drove me crazy, I did an overhaul. This was one of the additions that I bought to not only give me more space but also allow for better cable management. I mounted mine under my desk, which let me contain the cable chaos beneath the desk.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 25, 2025
C
Verified Purchase
Cody
Belleville, US
★★★★★ 5
Fits great.
Multiple iterations of this dock have wires coming out both the front and back, making it ugly on the desk and no way to hide wires well. Mounting under the desk with this helped a ton, looks way better. Perfect fit.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 12, 2025
H
Verified Purchase
harlin
Battle Creek, US
★★★★★ 5
Great product
My package was stolen a d they provided a replacement right away!! Great support and good product love it
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 15, 2026
R
Ryan Y.
Birmingham, US
★★★★★ 5
Heavy-Duty Solution for Large Towers — Rock Solid
This CPU holder is exactly what I needed to reclaim my desktop workspace. I wanted to get the computer off the desk to clear up room for projects, but I didn't want to put it on the floor where it’s susceptible to static and pet hair. This mount keeps the tower tucked away under the desk but still within easy reach. Build Quality & Weight: The unit is impressively well-built with sturdy steel. While the specs state it can hold up to 44 lbs, my current build is closer to 20 lbs, and it handles it with zero flex or wobble. It feels very secure once locked in. Design & Airflow: One of the best benefits I’ve noticed is the noise reduction. Having the case mounted under the desk surface helps shield the sound of the fans, creating a quieter workspace. The open-frame design is also great for airflow and keeps all the ports easily accessible. It’s highly adjustable (width 7.7” to 11.8” and height 20” to 25.8”), so it should fit almost any full-size case. Installation Tip: Installation was straightforward, though I’d recommend measuring your desk thickness first to ensure it can support the weight. If you’re looking for a solid, full-size PC holder to keep your system off the floor, this is a great choice. It feels like a professional-grade mount that will last through several different builds.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 7, 2026
R
Richard
Draper, US
★★★★★ 4
Great way to keep your PC off the floor, especially with a standing desk
This mount is a great solution if you want to get your desktop tower off the floor and clean up the space around your desk. The construction feels very solid and once installed it holds the PC securely without any wobble. I like that the frame is adjustable so it can fit different case sizes, and the open design allows for good airflow while still supporting the case well. It is especially helpful if you have a standing desk. Keeping the tower mounted under the desk means all of the cables move with the desk when it raises or lowers, which makes everything much cleaner and easier to manage. Installation takes a little planning to line things up correctly, but once it is mounted it feels very secure. If you want a cleaner workspace and a better setup for a standing desk, this mount works really well.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 14, 2026

recommand products