SKU: 26074394227

Human ANGPTL3,His tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 30 - Sep 4

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human ANGPTL3,His tagProduct Specification Species Human Synonyms Angiopoietin related protein 3, Angiopoietin 5 (ANG 5), Angiopoietin like protein 3, ANGPT5 Accession Q9Y5C1 Amino Acid Sequence Protein sequence(Q9Y5C1, Ser17 Glu460, with C 10*His)

Product Specification


Species Human
Synonyms Angiopoietin-related protein 3, Angiopoietin-5 (ANG-5), Angiopoietin-like protein 3, ANGPT5
Accession Q9Y5C1
Amino Acid Sequence

Protein sequence(Q9Y5C1, Ser17-Glu460, with C-10*His) SRIDQDNSSFDSLSPEPKSRFAMLDDVKILANGLLQLGHGLKDFVHKTKGQINDIFQKLNIFDQSFYDLSLQTSEIKEEEKELRRTTYKLQVKNEEVKNMSLELNSKLESLLEEKILLQQKVKYLEEQLTNLIQNQPETPEHPEVTSLKTFVEKQDNSIKDLLQTVEDQYKQLNQQHSQIKEIENQLRRTSIQEPTEISLSSKPRAPRTTPFLQLNEIRNVKHDGIPAECTTIYNRGEHTSGMYAIRPSNSQVFHVYCDVISGSPWTLIQHRIDGSQNFNETWENYKYGFGRLDGEFWLGLEKIYSIVKQSNYVLRIELEDWKDNKHYIEYSFYLGNHETNYTLHLVAITGNVPNAIPENKDLVFSTWDHKAKGHFNCPEGYSGGWWWHDECGENNLNGKYNKPRAKSKPERRRGLSWKSQNGRLYSIKSTKMLIHPTDSESFEGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical:53.4kDa Actual:70kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Angiopoietin-like 3, also known as ANGPTL3, is a member of the angiopoietin-like family of secreted factors. It is expressed predominantly in the liver, and has the characteristic structure of angiopoietins, consisting of a signal peptide, N-terminal coiled-coil domain, and the C-terminal fibrinogen (FBN)-like domain. The FBN-like domain in angiopoietin-like 3 protein was shown to bind alpha-5/beta-3 integrins, and this binding induced endothelial cell adhesion and migration. This protein may play a role in the regulation of angiogenesis. ANGPTL3 also acts as dual inhibitor of lipoprotein lipase (LPL) and endothelial lipase (EL),[7] thereby increasing plasma triglyceride, LDL cholesterol and HDL cholesterol in mice and humans.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 26074394227

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 11 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Amazon Customer
Lowell, US
★★★★★ 5
Premium Pillows
Team Name: Pack of 2, Size: Queen - 20" x 30", Color: White
Purchase these as a gift for1 of my children that had terrible pillows. To say she was pleased would be an understatement. She said that these were some of the softest and most comfortable pillows she had ever used. They remained puffy while conforming comfortably to her sleep style. She was absolutely in love and I would definitely purchase again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 3, 2026
J
Verified Purchase
Jennifer Hansen
Boise, US
★★★★★ 5
Perfect for me
Team Name: Pack of 2, Size: Queen - 20" x 30", Color: White
I love these pillows. At first they felt a little firmer than I wanted but they quickly became very comfortable and just want I wanted. Seems to be great quality.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 29, 2026
D
Verified Purchase
DinhFamily
Lowell, US
★★★★★ 3
stiff pillows
Team Name: Pack of 2, Size: Queen - 20" x 30", Color: White
These pillows are quite stiffer than i expected but i guess that means they keep their shape.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 8, 2026
J
Verified Purchase
John Slade
Waukegan, US
★★★★★ 5
This is my third time purchasing these nice and comfortable pillows
Team Name: Pack of 2, Size: Queen - 20" x 30", Color: White, Team Name: Pack of 2, Size: Queen - 20" x 30", Color: White
This will be my third time purchasing these pillows. I and my many guests that have had the opportunity to be able to use these pillows in my guest room have spoke of the wonderful and comfortable they were sleeping with them. And they seem to hold up well and are structured nicely as not to lose there stitching in there construction. I am very please and feel the cost is quite reasonable to store pillows in there purchase price category. Kind regards, J Slade
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 25, 2026
R
Verified Purchase
Rafael A
Waukegan, US
★★★★★ 5
⭐⭐⭐⭐☆ Comfortable pillows with good support
Color: White, Size: Queen (Pack of 2)
I purchased the EIUE Hotel Collection bed pillows (2 pack) looking for something comfortable and supportive, and overall they’ve been a good addition to my bed. The pillows arrived well packaged and fluffed up nicely after opening. They feel soft but still provide decent support for sleeping. I’m mostly a side and back sleeper, and these pillows have worked well without feeling too flat. They hold their shape better than I expected and don’t require constant fluffing during the night. The fabric feels smooth and breathable, which helps keep them comfortable. My only small downside is that they’re slightly softer than what I personally prefer, but that really comes down to personal preference. Overall, these are comfortable, good-quality pillows that offer nice support and value for the price. I’d recommend them if you’re looking for hotel-style pillows that are soft yet supportive.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 15, 2025

recommand products