SKU: 2891188935

Human IgG2 Fc

Sale price$40.50 Regular price$45.00
Save 10%

Pay in installments of $11.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 1 - Sep 6

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human IgG2 FcProduct Specification Species Human Synonyms Ig gamma 2 chain C region, Ig gamma 2 chain C region DOT, Ig gamma 2 chain C region TIL, Ig gamma 2 chain C region ZIE Accession P01859 Amino Acid Sequence Protein sequence(P01859, Glu99 Lys326(V161M, S257A), no tag)

Product Specification


Species Human
Synonyms Ig gamma-2 chain C region, Ig gamma-2 chain C region DOT, Ig gamma-2 chain C region TIL, Ig gamma-2 chain C region ZIE
Accession P01859
Amino Acid Sequence

Protein sequence(P01859, Glu99-Lys326(V161M, S257A), no tag) ERKCCVECPPCPAPPVAGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFNWYVDGMEVHNAKTKPREEQFNSTFRVVSVLTVVHQDWLNGKEYKCKVSNKGLPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight Theoretical:25.7kDa Actual:30kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Tag N/A
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, 1mM EDTA, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

The fragment crystallizable region (Fc region) is the tail region of an antibody that interacts with cell surface receptors called Fc receptors and some proteins of the complement system. This property allows antibodies to activate the immune system. Fc binds to various cell receptors and complement proteins. In this way, it mediates different physiological effects of antibodies (detection of opsonized particles; cell lysis; degranulation of mast cells, basophils, and eosinophils; and other processes).

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 2891188935

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.9 ★★★★★
Based on 6 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
K
Verified Purchase
Kelypsoo
Omaha, US
★★★★★ 5
Need Battery's
Size: 31 x 7, Color: Black-rgb, Size: 31 x 7, Color: Black-rgb
Good floating shelves. I mounted the light strip on the top instead of the bottom because they don't stick well. For the price I wish they came with a set of batteries for the pack and the remote. But over all sturdy and well made.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 25, 2026
S
Verified Purchase
Shawn
Carnegie, US
★★★★★ 5
Very happy
I recently purchased a set of floating shelves, and I couldn't be happier with my decision! From the moment I opened the box, I was impressed by the quality of the materials. The shelves are sturdy and well-crafted, giving me confidence that they will hold my books and decorative items without any issues. Installation was a breeze! The package came with clear instructions and all the necessary hardware, making the process quick and hassle-free. I was able to mount them in no time, and I appreciated how everything lined up perfectly. As for the aesthetics, these shelves are a game changer for my space! They add a modern touch to my room and provide a stylish way to display my favorite pieces. The sleek design complements my décor beautifully, and I've received so many compliments from friends and family. Overall, these floating shelves exceeded my expectations in every way. They are not only functional but also enhance the look of my home. I highly recommend them to anyone looking for a stylish and easy-to-install shelving solution!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 22, 2025
J
Verified Purchase
Joey Kapinos
Natrona Heights, US
★★★★★ 4
Shelf is sturdy and made of good material, easy to assemble , LED strip could be better
Size: 24 x 6, Color: Black-rgb, Size: 24 x 6, Color: Black-rgb
The shelf is built of solid material and it is very easy to assemble and also install. The LED strip is okay, nothing special and if you don't flick the actual switch on/off of the battery pack your batteries will drain EXTREMELY FAST; the RGB will start flashing making it seem unusable/defective because the controller won't function properly either when in reality it's just dead batteries. I'd probably buy other LED strips that are of higher quality, rechargable and have more features if I were to purchase these again in the future. Pleased with the purchase overall though.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 14, 2026
K
Verified Purchase
katie casey
Louisville, US
★★★★★ 5
Great shelves and very sleek
Size: 31 x 7, Color: Black-rgb
Love these shelves so much. They have been holding up my Lego flower collection beautifully
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 2, 2026
I
Verified Purchase
Ivan
Dallas, US
★★★★★ 1
wasting your money
Size: 35 x 7, Color: White-rgb
I’m very disappointed with this purchase. The shelves have a questionable finish - honestly, you can get something cheaper and much better quality at IKEA. But the biggest issue is the lighting. None of the lights work. I put in brand-new batteries and absolutely nothing happens. I wouldn’t recommend wasting your money on this product.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 13, 2025

recommand products