SKU: 29921924456

Human IL-6, His tag

Sale price$128.25 Regular price$142.50
Save 10%

Pay in installments of $35.62 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 1 - Sep 6

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human IL-6, His tagProduct Specification Species Human Synonyms B cell stimulatory factor 2 (BSF 2), CTL differentiation factor (CDF), Hybridoma growth factor, Interferon beta 2 (IFN beta 2) Accession P05231 Amino Acid Sequence Protein sequence(P05231, Val30 Met212, with C 10*His)

Product Specification


Species Human
Synonyms B-cell stimulatory factor 2 (BSF-2), CTL differentiation factor (CDF), Hybridoma growth factor, Interferon beta-2 (IFN-beta-2)
Accession P05231
Amino Acid Sequence

Protein sequence(P05231, Val30-Met212, with C-10*His)
VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQMGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight

Theoretical: 22.4kDa Actual: 22-23kDa

Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 ℃ to -70 °C as supplied.

1 month, 2 to 8 °C under sterile conditions after reconstitution.  

Please avoid repeated freeze-thaw cycles. 

Background

Interleukin 6 (IL-6) is a prototypical cytokine for maintaining homeostasis. When homeostasis is disrupted by infections or tissue injuries, IL-6 is produced immediately and contributes to host defense against such emergent stress through activation of acute-phase and immune responses. However, dysregulated excessive and persistent synthesis of IL-6 has a pathological effect on, respectively, acute systemic inflammatory response syndrome and chronic immune-mediated diseases.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 29921924456

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 6 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
R
Verified Purchase
Robert L.
Lexington, US
★★★★★ 5
Absolutely great curved monitor for his PC. Samsung, top of the line can't go wrong!
Size: 32"
Bought this for my son's birthday / Christmas present because they are so close together. I think it was only about three or $400. But it is the Samsung which is a top rate item. And it has a curved screen for better viewing. That's what he wanted so that's what he got! LOL he said it works greatly and you can adjust so many settings such as the brightness the sound and everything else. Good size too! 32 inches that's like a TV screen LOL
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 3, 2026
J
Verified Purchase
Jum
Fort Morgan, US
★★★★★ 1
Worst interface on the market. A sadist designed it.
Size: 32"
Great screen. The absolute worst interface in the business. Who in their right mind would want their monitor to change inputs on a whim? Who would design a 6 step process to change that input back? Samsung did. I wish I had spent my hard earned money elsewhere. I waste more time fixing this stupid monitor then I do enjoying the games I play on it. It's nightmare fuel.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 15, 2026
J
Verified Purchase
Jaka M.
Omaha, US
★★★★★ 4
Smart Features Overkill (for me)
Size: 32"
This monitor arrived promptly and undamaged. The picture quality is excellent, and the refresh rate has my games looking silky-smooth. If it was a normal monitor without smart features, I would give it 5 stars. The smart capabilities make this somewhat obnoxious from time to time. I just had an update (that prompted this review) that had a pop-up box telling me Samsung policies have been updated, but I was unable to dismiss it with my mouse or keyboard. I had to wait for it to time out or use the remote. There are also countdown screens during boot-up and shut-down that can be annoying at times, though to be fair, I have not attempted to disable them. It also occasionally just likes to pop up notifications that aren't from my computer about input or monitor settings (not pc display settings). It's really a pretty small nuisance, but after a few months sometimes has me wishing I had just dropped the cash on a nicer 4k monitor w/out smart capabilities. I would imagine it being quite convenient in a dorm or small apartment setting if you were also using it as a smart tv on a regular basis. Not a bad product by any means, just a few extra bells and whistles that occasionally get in the way of how I typically use it. I picked it up on sale for right around $400 and feel that was fair. If I had to pay more, I would probably make the jump to 4k and shop at that higher price point instead.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 24, 2025
B
Verified Purchase
Brian
Battle Creek, US
★★★★★ 5
Its a TV too!
Size: 32"
I got this monitor for my computer for the most part. Excellent quality Colors are great, no dead pixels on arrival. Bright and easy to see. Comes with a remote which I thought was strange and put it aside for a few months. Then when I found the remote again I played with it and realized this was also a TV!! So for the price it is an amazing gaming monitor and a smart tv on top of that this is great value for the money. The curve may make it difficult to see as a tv if you are in a large space but for what it is made for there is no problem at all. And you can adjust if you do move around the room.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 21, 2025
M
Verified Purchase
Matt
New York, US
★★★★★ 5
Great Gaming Monitor at an Affordable Price
Size: 32"
Solid Monitor with a high quality image with strong blacks on a VA panel, fantastic 240hz refresh rate, quick response time. Comes with some extra built in UI features and a remote for TV like functions or cloud gaming, which I don't really need, seeing as I am using this exclusively as a PC monitor. But certainly not a downside. Wasn't perfect out of the box, but with a little calibration and optimizing, gaming at 240 FPS looks and feels great. Perfect alongside my old 1440p 144hz monitor as a second monitor, and my new PC. Able to hit those 1440p/240FPS marks with my 7950X3D and 7900XTX GPU. Would recommend at it's current sale price just under $500. If your looking to spend more, consider an OLED option in the $800-1000 range for a screen with comparable specs. Also has Freesync Premium Pro with an effecting range from 60-240FPS for system/titles that are unable to hit that 240hz refresh rate at all times. From my testing this seems most optimal from 120-240 FPS, 60-120 FPS seems a bit less effective. Either way great monitor for the money spent.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 11, 2023

recommand products