SKU: 35152705855

Human Geminin , His tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 1 - Sep 6

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human Geminin , His tagProduct Specification Species Human Synonyms GMNN Accession O75496 Amino Acid Sequence Protein sequence(O75496, Leu110 Ile209, with C 10*His) MLYEALKENEKLHKEIEQKDNEIARLKKENKELAEVAEHVQYMAELIERLNGEPLDNFESLDNQEFDSEEETVEDSLVEDSEIGTCAEGTVSSSTDAKPCIGGGGSHHHHHHHHHH Expression System E. coli Molecular Weight Theoretical: 13. 1kDa Actual: 19kDa Purity 95% by SDS PAGE Endotoxin <1EU g Tag His Tag Physical Appearance Lyophilized Powder Storage Buffer Lyophilized

Product Specification


Species Human
Synonyms GMNN
Accession O75496
Amino Acid Sequence

Protein sequence(O75496, Leu110-Ile209, with C-10*His)
MLYEALKENEKLHKEIEQKDNEIARLKKENKELAEVAEHVQYMAELIERLNGEPLDNFESLDNQEFDSEEETVEDSLVEDSEIGTCAEGTVSSSTDAKPCIGGGGSHHHHHHHHHH

Expression System E.coli
Molecular Weight Theoretical:13.1kDa Actual:19kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Geminin is a nuclear protein present in most eukaryotes and highly conserved across species, numerous functions have been elucidated for geminin including roles in metazoan cell cycle, cellular proliferation, cell lineage commitment, and neural differentiation. One example of its function is the inhibition of Cdt1. Geminin has been found to be overexpressed in several malignancies and cancer cell lines, while there is data demonstrating that geminin acts as a tumor suppressor by safeguarding genome stability.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 35152705855

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 21 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
T
Verified Purchase
Tian Z
Battle Creek, US
★★★★★ 5
convenient for going out
Size: 0.47 Ounce (Pack of 1)
Bought this several times. Texture is better than other sunscreen products.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 24, 2026
J
Verified Purchase
Jessica Richart
Port Orchard, US
★★★★★ 5
Love
Size: 0.47 Ounce (Pack of 1)
Love the sunscreen stick! Very easy to use and works well for my toddler with sensitive skin.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 18, 2026
L
Verified Purchase
Lacy
Los Angeles, US
★★★★★ 5
Go-To for Reef-Safe & Light-Weight Sunscreen
Style: SPF 50 Roll On, Size: 3 Fl Oz (Pack of 1)
Favorite sunblock to travel with. Appreciate the simplicity of it, and the fact that it rolls on and rubs in smooth. Of course the iconic scent is also a plus.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 18, 2026
J
Verified Purchase
Jenny J
New York, US
★★★★★ 5
Great choice
Style: SPF 50 Roll On, Size: 3 Fl Oz (Pack of 1)
After I suffered a second-degree burn from steam, I was told by my doctor that I would have to keep my new fresh skin sun-blocked for up to a year to avoid any scarring or hyper pigmentation. This has been a great selection as it is a roll-on, Which helps a lot with preventing messes that can happen with traditional sunblock bottles. I also like that it is easy to travel with, and the fact that it is zinc based.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 26, 2025
A
Verified Purchase
A reader
Alexandria, US
★★★★★ 5
My favorite new mineral sunscreen!
Style: SPF 50 Roll On, Size: 3 Fl Oz (Pack of 1)
This is my favorite new mineral sunscreen! I've been searching for years for a product that is easy to apply, not messy, and doesn't show up too white. This roll-on is the perfect solution. I keep it near the front door and quickly roll the sunscreen on my hands, arms, and chest before leaving the house. The sunscreen applies so quickly and uniformly-- there are no bare spots or messy globs to rub in. Also, the roll-on keeps the sunscreen from oozing out of the tube and getting all over everything. Finally, the roll-on method also eliminates the frustration of having half-filled tubes and pumps where you can't even access the sunscreen when the tube gets low. Here's hoping this doesn't happen with the roll-on. Thank you Sun Bum for creating this wonderful product. I also love the reasonable price.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 24, 2025

recommand products