SKU: 4376509055

Human NF-H(Neurofilament heavy polypeptide) , His tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 1 - Sep 6

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human NF-H(Neurofilament heavy polypeptide) , His tagProduct Specification Species Human Synonyms 200 kDa neurofilament protein; Neurofilament triplet H protein; NEFH; KIAA0845; NFH Accession P12036 Amino Acid Sequence Protein sequence(P12036, Met1 Gln100, with C 10*His) MMSFGGADALLGAPFAPLHGGGSLHYALARKGGAGGTRSAAGSSSGFHSWTRTSVSSVSASPSRFRGAGAASSTDSLDTLSNGPEGCMVAVATSRSEKEQGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Theoretical: 11. 5kDa Actual: 11 30kDa Purity 95% by SDS PAGE Endotoxin <1EU g

Product Specification


Species Human
Synonyms 200 kDa neurofilament protein; Neurofilament triplet H protein; NEFH; KIAA0845; NFH
Accession P12036
Amino Acid Sequence

Protein sequence(P12036, Met1-Gln100, with C-10*His)
MMSFGGADALLGAPFAPLHGGGSLHYALARKGGAGGTRSAAGSSSGFHSWTRTSVSSVSASPSRFRGAGAASSTDSLDTLSNGPEGCMVAVATSRSEKEQGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical:11.5kDa Actual:11-30kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, 1mM EDTA, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Neurofilament, heavy polypeptide (NEFH) is a protein that in humans is encoded by the NEFH gene.It is the gene for a heavy protein subunit that is combined with medium and light subunits to make neurofilaments, which form the framework for nerve cells.Mutations in the NEFH gene are associated with Charcot-Marie-Tooth disease. Neurofilament heavy (NEFH) is one of the critical proteins required for the formation of the neuronal cytoskeleton and polymorphisms in NEFH are reported as a rare cause of sporadic ALS (sALS).

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 4376509055

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 14 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
P
Verified Purchase
Plant ecology
Louisville, US
★★★★★ 5
Love my Yamahas
Set name: 5.1 Receiver
RX 385 replaces my much-loved 10 year old RX 375, which I inadvertently fried while experimenting. The 385 has some newer features, including bluetooth. The old model and this both use the handy YPAO function to tune the audio speakers' depth of field to the listening environment. It's a broadcast mic that you just plug into the front of the receiver for a few seconds to determine each speakers' distance from viewer. Kind of a sonic echo measurement of seating to speaker. It's a foolproof, remarkably clever, timesaving gizmo. The YPAO mic is absolutely included with this unit, looks like a little plastic cone. Also important to me, Yamaha has replaced the old spring clips for rear/side speakers, which are now the better screw and cap posts, as they have always been for the two front speakers. I recommend rocketfish HDMI 4k/8k cables to connect this receiver to your tv and to whatever other components you want, such as a bluray. Sound quality is excellent if your speakers are good. (I like KEFs.) Of course you may prefer wireless speakers, but I'm already committed to wired ones. I used rocktfish banana plugs to connect my speaker wires to the RX 385 receiver's speaker posts. Neat and clean. With a choice of 2 front, 2 rear, 1 center speaker, plus one coaxial plug in for a subwoofer, your movies and programs are going to sound far more detailed and staged than you'd get from the tv or a sound bar. It's a more immersive and compelling experience. (I use only 2 fronts and 2 rears and don't feel I'm missing anything.) Yamaha receivers and other components are my favorites: relatively inexpensive, well designed, solidly built, and not fussy to install. If you find yourself in a pickle there are a couple of helpful youtube videos. I find with the RX385 again that Yamaha does not disappoint me.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 18, 2023
P
Verified Purchase
phil
Alexandria, US
★★★★★ 5
Great unit
Set name: 5.1 Receiver
Works great, was worried about having my hdmi run through it thinking id have to use it all the time but leaving it off the signal still goiles through to the TV. Very rleasy to hook up and very easy to use.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 8, 2026
K
Verified Purchase
kpdrumswritessings
Fort Morgan, US
★★★★★ 5
real time and energy saver, as well as $
Size: 16AWG Wiring Harness-2 Leads
If you have a set of LED lights that didn't come with a harness , you can't beat this for the price. By the time you figure in the cost of the parts ( wire, switch, crimps/connectors, not to mention a relay if you are using one) to hardwire a set of lights, let alone the time to assemble, this set up is cheaper by far. harness length is ample, you get a pair of pigtails with connectors for a pair of lights, the relay, switch, fuse block and fuse, and ring terminals for power all assembled for what a switch and some wire would cost. Made everything quick, cheap, and easy.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 17, 2024
M
Verified Purchase
Miguel
Omaha, US
★★★★★ 5
Great wiring harness for light installations.
Size: 16AWG Wiring Harness-2 Leads, Size: 16AWG Wiring Harness-2 Leads
This is a great wiring harness for LED lights. These come in one or two leads application. All that means is that they come ready for one or two lights, depending on your installation. The plug in connectors for each light comes with the set so that is a plus. I’ve attached a picture of the plug/connector for the lights so you can take a look at them. Although the relay is an “overkill” for low wattage LEDs, it’s OK to have it just in case you decide to change your lights for larger ones or halogens, in the future. In my case I will be using this harness in my motorcycle. It is very long for my need, which is great for cars, but too long for motorcycles since you have to remember that room/space is scarce in motorcycles. I ended up cutting the wires to my desired length and using heat shrink butt connectors and “glued” heat shrink covers for waterproofing the connection points. All in all these are great quality and I am very happy with them.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 16, 2020
M
Verified Purchase
Marina De Leon
Waukegan, US
★★★★★ 5
Nice
Size: 16AWG Wiring Harness-2 Leads
Worked great, easy to install
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 8, 2026

recommand products