SKU: 44075796855

Human IL-17A, His tag

Sale price$153.00 Regular price$170.00
Save 10%

Pay in installments of $42.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 1 - Sep 6

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human IL-17A, His tagProduct Specification Species Human Synonyms Cytotoxic T lymphocyte associated antigen 8 (CTLA 8) Accession Q16552 Amino Acid Sequence Protein sequence(Q16552, Gly24 Ala155, with C 10*His) GITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVAGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Theoretical: 16. 8kDa Actual: 17, 20kDa Purity 95% by SDS PAGE Endotoxin

Product Specification


Species Human
Synonyms Cytotoxic T-lymphocyte-associated antigen 8 (CTLA-8)
Accession Q16552
Amino Acid Sequence

Protein sequence(Q16552, Gly24-Ala155, with C-10*His) GITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVAGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical:16.8kDa Actual:17, 20kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, 1mM EDTA, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

IL-17A is a proinflammatory cytokine produced by activated T cells. This cytokine regulates the activities of NF-kappaB and mitogen-activated protein kinases. This cytokine can stimulate the expression of IL6 and cyclooxygenase-2 (PTGS2/COX-2), as well as enhance the production of nitric oxide (NO). High levels of this cytokine are associated with several chronic inflammatory diseases including rheumatoid arthritis, psoriasis and multiple sclerosis.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 44075796855

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 27 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
C
Verified Purchase
Christian
New York, US
★★★★★ 5
High quality product
Size: Twin, Color: White
High quality!! It was exactly what I was looking for.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 3, 2026
A
Verified Purchase
Amazon Customer
West Palm Beach, US
★★★★★ 1
Broke nearly immediately
Size: Queen, Color: Walnut, Size: Queen, Color: Walnut
Terrible. Broke after a month or so of normal use. DO NOT BUY
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 12, 2026
G
Verified Purchase
GUSTAVO Arriens
Bozeman, US
★★★★★ 5
Simple and not Drama claim process.
’ve had Asurion coverage for a couple of years and never needed to use it until recently, when my pool salt cell (less than two years old) stopped working. I had purchased it with an Asurion protection plan, so I contacted them to start a claim. The process was simple and straightforward to follow. In the end, they honored the plan and covered the cost of my salt cell based on the value when I originally bought it. They issued me a gift card that I could use on Amazon for that amount. While prices have gone up and a new cell now costs about $200 more, it was still definitely worth having the coverage. Overall, I’m satisfied with how the claim was handled.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 8, 2026
L
Verified Purchase
lele
Chelsea, US
★★★★★ 5
Love this protection plan
Quick and easy. My daughter's cracked her screen on her phone, as soon as it happened I went on the app, filed the claim. Ten minutes later I received the email with the shipping lable. The following day I dropped the phone off at ups and 4 hours later I received the digital gift card. Ive filed several claims since getting the protection plan and with four kids its definitelysomething im glad to have especially since i dont have to buy a protectionplan for each item now. I have filed claims for electric scooter the stoped working for no reason, my son's phone stopped charging, my oldest daughter cracked her phone screen, my son's video game controllers up and died and each time it was quick and easy and no fuss
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 13, 2026
M
Verified Purchase
Miguel Denyer
Pawtucket, US
★★★★★ 1
Don't waste your money - these people will not help you
On March 9th 2024, I purchased a MCombo Lift Chair costing $785. On the same day, through the same Amazon account (my PERSONAL account since I also have a business account), I purchased an Asurion Complete Protect policy at the cost of $16.99 per month plus taxes. About one month ago, a problem arose with the chair that required me to make a claim using the "Complete Protect" policy that I had purchased for that very item. The claim was initiated on January 1st, 2025 - On January 3rd, I received an email asking me for photographs showing the damage for which I was making a claim. I sent those photographs via email to the address provided on January 6th. On January 27th, having not received ANY response from Asurion, I contacted them via phone and was told that my purchase had been made with a business account, that it was being used for business purposes, and was therefore not covered. I assured the Asurion Representative that it was most certainly not a business use, and that the chair that I was claiming for had been purchased because I had extensive shoulder surgery done that made it impossible to get in and out of bed. After speaking (unsuccessfully) with the Asurion Rep, I then contacted Amazon Customer Service. I spoke with an Amazon Customer Service Representative on the phone who confirmed that I had in fact used my personal account to purchase the chair and the Asurion Complete Protect policy. That representative went on to send a message to Asurion on my behalf confirming that the purchase was for personal use and not business use. Asurion responded, asking me to call them with the order number for the Asurion purchase. The number I gave was the exact same order number on my order history, however, the Asurion Rep could not find it. I was finally able to discover that the order number in Asurion's system was entirely different and isn't even in the same format as an Amazon order number. Upon the Asurion representative finding my plan, she informed me that the chair was listed as being purchased for business use (despite Amazon confirming that it was NOT) but that I should give them "a couple of business days" to resolve the issue. Five business days later, still no response and so I called them again (Yesterday - February 1st 2025)... Lo and behold, I got the same crap yet again... the purchase was listed as business use and was therefore being denied, but she promised to remove the business use commentary and put the claim through again. Today, February 2nd, I called Amazon yet again to escalate and had to call THREE times because the first two calls resulted in me finally being connected to an Asurion representative (two different reps) and each time, the Asurion representative hung up the phone as soon as my name was mentioned. It has become clear to me that the Asurion "Complete Protect" policy is a SCAM - they will NOT take care of your issue, regardless of how long you've been paying. I have been paying every month since March 9th last year - so they've received over $170 from me thus far, with zero other claims, and if I am able to cancel right now, I will only receive $16.99 back. All I want, is the chair that I purchased the policy for coverage of, to be repaired or replaced. Asurion are NOT helping, and are actively avoiding contact. At this point, I am considering legal action against Asurion for fraud - perhaps even a Class Action. I'll wait and see if my issue gets resolved within the next 10 days or so.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 2, 2025

recommand products