SKU: 50470267750

Human MUC5AC , His tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 31 - Sep 5

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human MUC5AC , His tagProduct Specification Species Human Synonyms Gastric mucin, Major airway glycoprotein, Mucin 5 subtype AC, tracheobronchial, Tracheobronchial mucin, TBM Accession P98088 Amino Acid Sequence Protein sequence(P98088, Thr1850 Cys1950, with C 10*His) TSTPGSTSSSPAQTTPSTTSKTTETQASGSSAPSSTPGTVSLSTARTTPAPGTATSVKKTFSTPSPPPVPATSTSSMSTTAPGTSVVSSKPTPTEPSTSSCGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Theoretical: 11. 3kDa Actual: 20 120kDa Purity

Product Specification


Species Human
Synonyms Gastric mucin, Major airway glycoprotein, Mucin-5 subtype AC, tracheobronchial, Tracheobronchial mucin, TBM
Accession P98088
Amino Acid Sequence

Protein sequence(P98088, Thr1850-Cys1950, with C-10*His) TSTPGSTSSSPAQTTPSTTSKTTETQASGSSAPSSTPGTVSLSTARTTPAPGTATSVKKTFSTPSPPPVPATSTSSMSTTAPGTSVVSSKPTPTEPSTSSCGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical:11.3kDa Actual:20-120kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, 1mM EDTA, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

MUC-5AC is a large gel-forming glycoprotein. In the respiratory tract it protects against infection by binding to inhaled pathogens that are subsequently removed by mucociliary clearance. Overproduction of MUC-5AC can contribute to diseases such as asthma and chronic obstructive pulmonary disease, and has also been associated with greater protection against influenza infection. This protein has been linked to mucus hypersecretion in the respiratory tract and is associated to chronic obstructive pulmonary disease (COPD).

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 50470267750

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 20 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
D
Verified Purchase
Diana rojas
Phoenix, US
★★★★★ 5
Perfecto y escelente
This toner is perfect for all skin types. I've been using it for a long time.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 28, 2025
A
Verified Purchase
Aud5rey
Grantham, US
★★★★★ 5
Very gentle toner!
I’m so glad I found this. With my rosacea I have to be careful what I use on my face. This toner is very gentle and doesn’t hurt my face. Will keep ordering it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 13, 2025
J
Verified Purchase
JW_Amazon
Omaha, US
★★★★★ 5
My Go-To Toner After Trying Many Others
Scent: Unscented, Size: 12 Fl Oz (Pack of 1)
I’ve tried many toners over the years, including higher-end brands, and this one continues to stand out for both performance and price. It does exactly what I need without unnecessary extras. The formula feels gentle and effective, and I really appreciate that it’s alcohol free and fragrance free. Those two things are especially important to me, and this has been the only toner I’ve felt comfortable using during pregnancy. It doesn’t irritate my skin and fits easily into my daily routine. Despite the affordable price, it performs just as well—if not better—than many more expensive options I’ve used in the past. My skin feels clean and refreshed after using it, without any tightness or residue. Overall, this is a reliable, no-nonsense toner that delivers great results at a very reasonable price. If you’re looking for a simple, fragrance-free option that works well without breaking the bank, this is an easy recommendation.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 9, 2026
D
Verified Purchase
Dr. Nemo
Phoenix, US
★★★★★ 5
Liquid facial magic!
Scent: Coconut Water, Size: 12 Fl Oz (Pack of 1)
I love this stuff. I use it daily as part of my facial routine and it has become one of those products I don’t even think about anymore because it just works. It smells good without being overpowering and does a great job of helping control excessive oil buildup on my face. Nothing harsh, nothing drying, just clean and refreshed skin. Right after using this, I follow up with a facial moisturizer and the combo works beautifully. My skin feels balanced instead of tight or angry, which is exactly what I’m going for. I know the label says men can use this as an aftershave, but that’s a hard pass for me. I stick to soothing, purpose-built post-shave products, specifically from Wholly Kaw. That stuff smells like it was handcrafted by skincare deities who truly care about your face. This toner is staying firmly in the “daily skincare” lane, where it shines. Another big plus is how gentle it is. No burning, no weird tingling, no regret. Just a calm, refreshing step that makes my skin feel like it’s being treated with respect. And the price? Under $10. That alone keeps me coming back. Honestly, I think they could charge a few dollars more for how well this performs, but I won’t complain about paying less for fantastic facial liquid magic. Simple, effective, affordable, and a permanent part of my routine. My face approves.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 21, 2025
G
Verified Purchase
Gina Arnone
Natrona Heights, US
★★★★★ 5
THAYERS Lavender Witch Hazel Toner: Time-Tested Elegance in a Bottle!
Scent: Lavender, Size: 12 Fl Oz (Pack of 1)
Embarking on a journey down memory lane with THAYERS Lavender Witch Hazel Facial Toner has been nothing short of a delightful reunion. This timeless brand, known since my youth, has proven its mettle yet again. Let's dive into the aromatic, moisturizing wonder that is the Lavender Witch Hazel Toner: Quality Infused with Elegance (5/5): THAYERS brings a touch of timeless elegance to skincare, and this lavender-infused toner is no exception. The quality is unmistakable, leaving my skin feeling pampered and rejuvenated after each use. Cleansliness at its Best (5/5): The toner's prowess in cleansing is unparalleled. It effortlessly removes dirt and impurities, unveiling a refreshed and squeaky-clean complexion. My skin thanks me for this daily ritual of cleanliness. Moisturizing Magic (5/5): The moisturizing effect is like a gentle caress for the skin. Unlike some toners that leave your face feeling parched, THAYERS Lavender Toner ensures that my skin is not just clean but incredibly moisturized after every application. Refreshing Elixir (5/5): Ah, the refreshing burst of lavender! While opinions on the strength of the scent may vary, I find the lavender notes to be a delightful touch. The toner rejuvenates not just my skin but also my senses, making each application a mini spa moment. Better than the Expensive Competitors (5/5): Sometimes the best things come in unassuming packages. Users have attested that this toner outshines even pricier competitors, proving that quality doesn't always have to break the bank. Mixed Durability Verdict (4/5): Opinions are divided on durability, but for me, the overall benefits outweigh any minor considerations. The toner's efficacy in daily use makes it a staple in my skincare routine. Generations-Long Trust (5/5): THAYERS is a brand that has stood the test of time, transcending generations. Its legacy of trustworthiness extends beyond my own experience, connecting with others who have relied on its skincare wonders. Lavender Scent Aspiration (4/5): While I had hoped for a stronger lavender scent, the subtle notes are still a pleasant addition to my skincare ritual. The product's efficacy compensates for any scent expectations. In conclusion, THAYERS Lavender Witch Hazel Facial Toner is a testament to the enduring charm of a trusted brand. Its quality, cleanliness, and moisturizing benefits make it a staple in my skincare routine and a connection to the past. Whether you're a longtime fan or a newcomer, this toner is a timeless treasure for your skin. Cheers to THAYERS for continuing to deliver skincare excellence!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 17, 2024

recommand products