SKU: 69414171573

Human C1q , His tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 31 - Sep 5

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human C1q , His tagProduct Specification Species Human Synonyms Complement C1q subcomponent subunit A Accession P02745 Amino Acid Sequence Protein sequence(P02745, Glu23 Arg150, with C 10*His) EDLCRAPDGKKGEAGRPGRRGRPGLKGEQGEPGAPGIRTGIQGLKGDQGEPGPSGNPGKVGYPGPSGPLGARGIPGIKGTKGSPGNIKDQPRPAFSAIRRNPPMGGNVVIFDTVITNQEEPYQNHSGRGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Theoretical: 14. 7kDa Actual: 20 25kDa Purity 95% by SDS PAGE Endotoxin <1EU g Tag His Tag

Product Specification


Species Human
Synonyms Complement C1q subcomponent subunit A
Accession P02745
Amino Acid Sequence Protein sequence(P02745, Glu23-Arg150, with C-10*His) EDLCRAPDGKKGEAGRPGRRGRPGLKGEQGEPGAPGIRTGIQGLKGDQGEPGPSGNPGKVGYPGPSGPLGARGIPGIKGTKGSPGNIKDQPRPAFSAIRRNPPMGGNVVIFDTVITNQEEPYQNHSGRGGGGSHHHHHHHHHH
Expression System HEK293
Molecular Weight Theoretical:14.7kDa Actual:20-25kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage 12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

The complement component 1q (or simply C1q) is a protein complex involved in the complement system, which is part of the innate immune system. Antibodies of the adaptive immune system can bind antigen, forming an antigen-antibody complex. When C1q binds antigen-antibody complexes, the C1 complex becomes activated. Activation of the C1 complex initiates the classical complement pathway of the complement system. By virtue of its ability to bind to IgG and IgM containing immune complexes and activating the classical pathway, C1q acts as prototypical link between innate and adaptive immune wings of the immune system. The notion of C1q involvement in the pathogenesis of cancer is still evolving. C1q appears to have a dual role in cancer: tumor promoting as well as tumor-protective, depending on the context of the disease.
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 69414171573

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 23 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Verified Purchase
Miss Jane
Boise, US
★★★★★ 5
love love loved it
I am now 55 years old and i love shinny stuff, so i decided I wanted glitter for my hair. I found this and am in love. It is very fine glitter and it just goes on my hair every so subtly. It catches the sun just right and i sparkle just like my personality. Not too much too look crazy just enough to look nice. Looks good on the arms and legs too for a night of dancing.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 14, 2024
M
Verified Purchase
maria
Port Orchard, US
★★★★★ 5
Súper fácil de usar y de buena calidad
Buen producto fácil de usar live it I use for nails design
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 6, 2026
M
Verified Purchase
Maddison
Charlottesville, US
★★★★★ 4
Need base to use it
The bottles are well made and cute. There is plenty of glitter in them for whatever you need. HOWEVER- the glitter does not stick to your clothing or skin very well. I recommend some form of base to allow it to stick to you better. I applied lotion to my arms and neck, and that seemed to do the trick.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 13, 2024
L
Verified Purchase
Leeolie
Whiting, US
★★★★★ 5
Great Glitter
Color: Purple + 1 Refill Bottle
It worked multiple times, no issue. love the glitter. i recommend using a hair spray first then spray the glitter, overral its reall pretty!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 23, 2024
A
Verified Purchase
Alexis
Waukegan, US
★★★★★ 3
Goes on plentiful, but doesn't stay.
I enjoyed this glitter when I first applied it, but it falls off even if you use lotion or something to stick it to your face. It would be great to use as pixi dust, but not for facial glitter. I use a more dense glitter for my face to make sure it shows up. I use it in my hair, and that stays for a while, but it takes a lot to show up/ The containers are cute though and don't get clogged. There is no scent to it, which I am happy about because I did not want scent.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 2, 2023

recommand products