SKU: 72094247382

IRF3 His Tag Protein, Human

Sale price$201.60 Regular price$224.00
Save 10%

Pay in installments of $56.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 24 - Aug 29

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

IRF3 His Tag Protein, HumanProduct Specification Species Human Synonyms IIAE7, Interferon regulatory factor 3 IRF 3 Accession Q14653 Amino Acid Sequence Gly2 Ser427, with N terminal 8*His HHHHHHHHHHDYKDDDDKKRAAAKHLIERYYHQLTEGCGNEACTNEFCASCP

Product Specification


Species Human
Synonyms IIAE7, Interferon regulatory factor 3 IRF 3
Accession Q14653
Amino Acid Sequence

Gly2-Ser427, with N-terminal 8*His HHHHHHHHHHDYKDDDDKKRAAAKHLIERYYHQLTEGCGNEACTNEFCASCP HHHHHHHHGTPKPRILPWLVSQLDLGQLEGVAWVNKSRTRFRIPWKHGLRQDAQQEDFGIFQAWAEATGAYVPGRDKPDLPTWKRNFRSALNRKEGLRLAEDRSKDPHDPHKIYEFVNSGVGDFSQPDTSPDTNGGGSTSDTQEDILDELLGNMVLAPLPDPGPPSLAVAPEPCPQPLRSPSLDNPTPFPNLGPSENPLKRLLVPGEEWEFEVTAFYRGRQVFQQTISCPEGLRLVGSEVGDRTLPGWPVTLPDPGMSLTDRGVMSYVRHVLSCLGGGLALWRAGQWLWAQRLGHCHTYWAVSEELLPNSGHGPDGEVPKDKEGGVFDLGPFIVDLITFTEGSGRSPRYALWFCVGESWPQDQPWTKRLVMVKVVPTCLRALVEMARVGGASSLENTVDLHISNSHPLSLTSDQYKAYLQDLVEGMDFQGPGES

Expression System E.coli
Molecular Weight

48.2kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer 20mM Tris, 500mM NaCl, 1mM EDTA, 2mM DTT, pH8.0
Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1.J Cell Sci. 2019 Jul 24;133(5): jcs230409.
2.Science.2020 Oct 23;370(6515):eabd4570. Epub 2020 Sep 24.
3.Immunity. 2006 Sep;25(3):349-60.
4. Proc Natl Acad Sci U S A. 2016 Jun 14;113(24):E3403-12.Epub 2016 Jun 2.
5. Biochem Pharmacol. 2006 Nov 30;72(11):1469-76. Epub 2006 Jul 17.

Background

Regulatory factor (IRF) family - IRF-3 is the key transcriptional regulator of type I interferon (IFN)-dependent immune responses which plays a critical role in the innate immune response against DNA and RNA viruses. IRF3 regulates the transcription of type I IFN genes (IFN-alpha and IFN-beta) and IFN-stimulated genes (ISG) by binding to an interferon-stimulated response element (ISRE) in their promoters. It acts as a more potent activator of the IFN-beta (IFNB) gene than the IFN-alpha (IFNA) gene and plays a critical role in both the early and late phases of the IFNA/B gene induction. IRF3found in an inactive form in the cytoplasm of uninfected cells and following viral infection, double-stranded RNA (dsRNA), or toll-like receptor (TLR) signaling, is phosphorylated by IKBKE and TBK1 kinases. This induces a conformational change, leading to its dimerization and nuclear localization and association with CREB binding protein (CREBBP) to form dsRNA-activated factor 1 (DRAF1), a complex which activates the transcription of the type I IFN and ISG genes. It can activate distinct gene expression programs in macrophages and can induce significant apoptosis in primary macrophages.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 72094247382

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 26 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
K
Verified Purchase
Kindle Customer
Louisville, US
★★★★★ 5
Phenomenal book, one major criticism
Format: Kindle
Great book. Dalio does a remarkable job seeing the bigger picture and providing confidence through historical events/ever repeating cycles that you can predict at a high level what is coming next for a given country or the world and plan accordingly. The corkscrew of evolution analogy is a perfect one, where the human race has up and down cycles but always trends up longer term thanks to technological innovation. My one criticism is he speaks out of both sides of his mouth in one instance, presumably because he doesn’t want to upset any high ranking politicians or leaders he may be friends with, which I found to be disappointing. On the one hand, he notes at the start of the book that no two democracies have waged war with each other, wars have only been fought between dictators/police states and democracies or just dictators/police states. Then later on when discussing China, he all but excuses and rationalizes their increasingly authoritarian state, as seen by Xi crowning himself leader until death and abolishing the precedent of 2 5 year term limits as of 2018. He blesses the Chinese approach of a few rulers knowing what’s best for all, as if those rulers are acting in the broader interest of Chinese people, and that’s an acceptable alternative to democratic rule. He cites the recent video game ban as having merit or at least being understandable, suggesting that he thinks the ends can justify the means. All the while there’s no mention of the atrocities of Mao under this authoritarian type of rule, no mention of the Muslim genocide going on now, the suppression of free speech and jailings and beating and murders of those that oppose the current regime, no mention of internet censorship, etc. To bring the criticism full circle, he doesn’t link his first point on wars and authoritarians always being involved in them, with the fact that China is an authoritarian state and therefore it’s rise threatens the free world and human progress. Ironically, he does correctly acknowledge China’s opening up to market and establishment of capitalist principles for rocketing them toward the US in terms of power, while refuses to critique the political system despite its history of failings, violence and pain. Russia invading Ukraine couldn’t drive this point (ie the civil or political system being as important as the economic system to the long term success of a country and world peace) home any harder.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 12, 2022
H
Verified Purchase
Harold Hall
Natrona Heights, US
★★★★★ 5
Can be effectively used as a working tool for the predictor (not just for investments)
Format: Hardcover
This is one of the best works on the declining economy and US, associated possible revolution/civil war and later major power war, that is presented in a clear, convincing and replicable way. Kudos to Dalio!! More importantly, the contents of the book can be used to predict upcoming events rather than just perceiving the world on fire with several likely upcoming breakouts (e.g., war with China over Taiwan, the likely loss of our reserve currency, the unsustainable and uncontrollable burgeoning national debt which grows by a trillion USD every 100 days). The author makes a valid case that significant events are moving very rapidly and, for the rest of the 2020s, things are going to get a whole lot worse for the non-elites in our society. Of note, the book was actually written in 2020, published the next year, which then allows the readership now in 2025 to verify the accuracy the observations and predictions. Right on target!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 4, 2025
P
Verified Purchase
Peter Ganavazos
Phoenix, US
★★★★★ 5
Great book for understanding how the world works!
Format: Hardcover, Format: Hardcover
Dalio has a unique perspective on the topic of the changing world order. He is a successful businessman who has spent his career analyzing economic trends and patterns, and this book is a culmination of his findings. His writing is clear and concise, making complex economic concepts easy to understand. One of the best features of the book is its organization. The book is broken down into 14 chapters, each focusing on a different aspect of the changing world order. Dalio starts with the big picture, examining the major forces driving the changing world order, before delving into the specifics of each major empire, including the Dutch, British, American, Chinese, Soviet, and Japanese empires. Ultimately, he brings everything full circle by discussing the changing world order today and what the future may hold. Another great aspect of the book is the way that Dalio weaves history and economics together. He doesn't just present economic theories in a vacuum; he uses real-world examples to show how they have played out over time. For example, in Chapter 5, he discusses the Great Depression and how it shaped the changing world order in the 1930s and 1940s. He also uses the rise of populism in Chapter 7 to illustrate how economic inequality can lead to political instability. Overall, I would highly recommend "The Changing World Order" to any intelligent human interested in economics, history, or politics. This book is a must-read for anyone who wants to understand the forces shaping our world today and what the future may hold. As Dalio himself puts it, "understanding how the world works is essential if you want to accomplish your goals and live a fulfilling life." Here are some key takeaways from the book: The changing world order is driven by three major forces: the changing relative powers of countries, the changing relative productivity of countries, and the changing values of countries. The rise and fall of empires is a natural part of the changing world order. Each empire has its own unique characteristics, but they all follow a similar pattern of rise, peak, and decline. The post-World War II order was built on the idea of free trade and cooperation between nations. However, this order is now under threat due to rising nationalism and protectionism. China is currently on the rise and is likely to become the world's dominant economic power in the coming decades. However, although this rise is not guaranteed, and there are many challenges that China will need to overcome, the US needs to step up its game on several fronts to compete. The future of the world order is uncertain, but there are a few things we can say with some degree of certainty. For example, the rise of automation and artificial intelligence is a hot topic today likely to have a major impact on the global economy in the coming years. Overall, "The Changing World Order" is a well-written and informative book that is sure to appeal to a wide range of readers. Whether you're a history buff, an economics nerd, or just someone who wants to better understand the world we live in, this book is well worth your time. As Dalio himself says, "The more you know, the more you'll understand, and the more you'll be able to make informed decisions about your own life." Five stars from me, give it a read!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 9, 2023
J
Verified Purchase
Jayme
Carnegie, US
★★★★★ 5
10/10 Recommend
Format: Hardcover
I took Jeffrey Sachs's Globalization class on EDX Academy and somehow stumbled upon this book in between class and finding books around the subject. I watched his youtube video that generalizes the book and was blown away by how my current class I was taking aligned with it. This book is an easy read, and especially for those who aren't well-versed about world history and world economics. I will admit that I do love history, and am learning economics, so this book was a beautiful way merge all these timelines together. The book breaks down and summarizes key points in world history and economics to make points to get the message across each chapter. Font size is great! Might even be considered larger compared to other books. The only thing I wish this book provided was thicker paper in the physical book itself, especially for the hardcover version. If Ray Dahlio ever comes out with a special edition of this with a higher quality paper, I would gladly purchase it for my collection.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 2, 2025
K
Verified Purchase
Kathy
Lake Worth, US
★★★★★ 5
Excellent book – exciting and educational!
Format: Paperback
This book is a true gem! It took us on a journey back in time and revealed the real story of the Olympic Games in a simple, vivid, and perfectly understandable way for children. My young students loved it, and I found it extremely useful and well-written. Ideal for kids who love history, sports, or simply want to learn something different in a fun way. Highly recommended!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 9, 2025

recommand products