SKU: 84685548399

Human CEA, His Tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 30 - Sep 4

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CEA, His TagProduct Specification Species Human Accession P06731 Amino Acid Sequence Protein sequence (P06731,CEAM 5, Lys35 Ser680, with C 10*His)

Product Specification


Species Human
Accession P06731
Amino Acid Sequence

Protein sequence (P06731,CEAM-5, Lys35-Ser680, with C-10*His)


KLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNKLSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSGGGGSHHHHHHHHHH.

Expression System HEK293
Molecular Weight 72.5 kDa (Reducing)
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer 0.2M PBS, pH7.4
Reconstitution Reconstitute at less than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

Within 1 month, 2 to 8 °C under sterile conditions after reconstitution. 12 months from date of receipt, -20 to -80 °C as supplied. Avoid repeated freeze-thaw cycles.

Background

CEA (carcinoembryonic antigen) is an acidic glycoprotein with the characteristics of human embryo antigen. It exists on the surface of cancer cells derived from endodermal cells and is a structural protein of cell membrane. This protein is formed in the cytoplasm and secreted into the surrounding body fluids. Therefore, it can be detected in various body fluids and excreta such as serum, cerebrospinal fluid, breast milk, gastric juice, pleural and abdominal fluid, urine and feces. As a specific marker for the early diagnosis of colon and rectal cancer, CEA level is found to increase not only in gastrointestinal malignancies, but also in serum of breast cancer, lung cancer and other malignancies through a large number of clinical practices.Therefore, CEA is a broad-spectrum tumor marker. Although it cannot be used as a specific index for the diagnosis of certain malignant tumors, it still has important clinical value in the differential diagnosis, disease monitoring and efficacy evaluation of malignant tumors.This product is the recombinant human CEA protein expressed from human 293 cells (HEK293).

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 84685548399

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 15 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
N
Verified Purchase
NikkiB
Massapequa, US
★★★★★ 5
Overpriced but it works.
Size: 1.3 Fl Oz (Pack of 1)
I hate that I love this product. It's stupid expensive. But it's great for broken/damaged/recovering skin. I've used it post microneedling and it is the only thing that soothes, hydrates, and doesn't sting raw, red skin. Great for rashes/hives and allergic reactions too. Luckily a thin layer is often enough to do the trick. so it lasts a long time I wouldn't use for everyday moisture, but when your skin is angry, this stuff works. (Overpriced? Yes. Witchcraft? Maybe. Does it work? Yep.)
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 10, 2025
E
Verified Purchase
English farmhouse
New York, US
★★★★★ 5
Works wonder
Size: 1.3 Fl Oz (Pack of 1)
Amazing product. The scars from my daughter acne are mostly gone after 1 month. We will purchase again
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 27, 2026
D
Verified Purchase
Dr. Erika Zeledón.
Natrona Heights, US
★★★★★ 5
Calm redness
Excellent cream. Bioderma Sensibio AR is very soothing and perfect for sensitive skin prone to redness. It feels lightweight, hydrates well, and helps calm the skin quickly. High quality formula and very gentle on the skin. Highly recommend. ⭐⭐⭐⭐⭐
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 27, 2026
L
Verified Purchase
Lori L.
Fort Morgan, US
★★★★★ 5
This works!
I’ve got Rosacea and not only does this really calm down the redness it works well with my makeup. Doesn’t pill at all. Absorbs really well, no scent or at least I do not detect it. Does not irritate my skin.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 28, 2026
S
Verified Purchase
Snow
Cuba, US
★★★★★ 5
The only option for reactive skin
I have EXTREMELY sensitive skin that breaks out in either a rash or acne with anything i try to put on it. This is the only lotion i can use. My sister is the same. Anytime i switch to something cheeper, i eventually come back to this!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 5, 2026

recommand products