Pay in installments of $25.00 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Sep 1 - Sep 6
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
Mouse TMEM119 , His tagProduct Specification Species Mouse Synonyms Osteoblast induction factor (OBIF) Accession Q8R138 Amino Acid Sequence Protein sequence(Q8R138, Thr100 Val280, with C 10*His) TFLIMFIVCAALITRQKHKATAYYPSSFPEKKYVDQRDRAGGPRTFSEVPDRAPDSRHEEGLDTSHQLQADILAATQNLRSPARALPGNGEGAKPVKGGSEEEEEEVLSGQEEAQEAPVCGVTEEKLGVPEESVSAEAEGVPATSEGQGEAEGSFSLAQESQGATGPPESPCACNRVSPSVGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Theoretical: 20. 8kDa Actual: 28kDa Purity
Product Specification
| Species | Mouse |
| Synonyms | Osteoblast induction factor (OBIF) |
| Accession | Q8R138 |
| Amino Acid Sequence |
Protein sequence(Q8R138, Thr100-Val280, with C-10*His) TFLIMFIVCAALITRQKHKATAYYPSSFPEKKYVDQRDRAGGPRTFSEVPDRAPDSRHEEGLDTSHQLQADILAATQNLRSPARALPGNGEGAKPVKGGSEEEEEEVLSGQEEAQEAPVCGVTEEKLGVPEESVSAEAEGVPATSEGQGEAEGSFSLAQESQGATGPPESPCACNRVSPSVGGGGSHHHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | Theoretical:20.8kDa Actual: 28kDa |
| Purity | ＞90% by SDS-PAGE |
| Endotoxin | <1EU/μg |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4. |
| Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
| Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles. |
Background
TMEM119 is known as a microglia-specific and robustly expressed trans-membranous molecule, which is not expressed by other macrophages and immune or neuronal cells, and forms, therefore, the most promising microglia marker to date. TMEM119 has served as a reliable immunohistochemical microglia marker for neurodegenerative diseases since then and was recently stained by an adapted protocol for immunocytochemistry even in postmortem CSF samples of trauma cases.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy