SKU: 17791292810

Human VEGF 121, His tag

Sale price$166.50 Regular price$185.00
Save 10%

Pay in installments of $46.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 30 - Sep 4

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human VEGF 121, His tagProduct Specification Species Human Accession P15692 9 Amino Acid Sequence Protein sequence(P15692 9, Ala27 Arg147, with C 10*His) APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKCDKPRRGGGGSHHHHHHHHHH Expression System CHO Molecular Weight Theoretical: 15. 7kDa Actual: 16kDa Purity 90% by SDS PAGE Endotoxin <1EU g Tag His Tag Physical Appearance Lyophilized Powder Storage Buffer

Product Specification


Species Human
Accession P15692-9
Amino Acid Sequence

Protein sequence(P15692-9, Ala27-Arg147, with C-10*His) APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKCDKPRRGGGGSHHHHHHHHHH

Expression System CHO
Molecular Weight

Theoretical:15.7kDa Actual:16kDa

Purity

>90% by SDS-PAGE

Endotoxin <1EU/μg
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Vascular endothelial growth factor (VEGF-121) is a naturally-occurring VEGF-A splice variant involved in embryonic vasculogenesis and angiogenesis. VEGF binds to VEGFR-1 and VEGFR-2, and activates Raf/MEK/ERK and PI3K/AKT pathways. VEGF-121 is released as a freely diffusible protein by a variety of normal and transformed cells. It plays an important role in neurogenesis both in vitro and in vivo. It has neurotrophic effects on neurons of the central nervous system and promotes growth and survival of dopaminergic neurons and astrocytes. VEGF also promotes growth and survival of vascular endothelial cells, monocyte chemotaxis, and colony formation by granulocyte-macrophage progenitor cells.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 17791292810

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 12 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
P
Pep247
Belleville, US
★★★★★ 5
Works well, spacious
Color: Black, Color: Black
Quality: This holder is actually really nice. It feels sturdy and well made, not flimsy or cheap at all. The material has a solid feel to it, and it holds everything in place without tipping or sliding around. Size and Capacity: This thing is bigger than I expected in a good way. There is plenty of space for multiple sponges, scrubbers, and even a small bottle of dish soap without everything feeling crammed together. It also has a removable compartment specifically for longer dish brushes, which is really convenient. It keeps them upright and separate so they are not just laying across everything else. Use and Functionality: The functionality is great. It is very easy to use and keeps everything organized and in one spot instead of scattered around the sink. One of the best parts is the drainage. Any excess water drains right back into the sink, and I have not had any issues with water pooling at the bottom. That alone makes a big difference in keeping things cleaner and less messy. Overall, It looks good, feels good, and does exactly what it is supposed to do. Good quality, very functional, and worth the price. Definitely a solid kitchen sink organizer.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 30, 2026
E
Verified Purchase
E. J. Kenny
Massapequa, US
★★★★★ 4
Works as expected
Color: Black
Works as expected
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 17, 2026
S
shell
New York, US
★★★★★ 5
Every kitchen needs one of these!!!
Color: Black, Color: Black
Whoever designed this is absolutely brilliant!! I have had so many sponge holders that either sit on the edge of the sink and make a big huge mess or they’re attached to the inside of the sink with suction cups and they fall off and they get in the way. This one is absolutely perfect. It has a little tray built-in on a slant so when you set your sponge or whatever in there, the water runs down back into the sink. No more water puddling on the sink running onto the counter. This drains it right back in the sink automatically I am thrilled with this sponge holder !! It’s a nice color and very well-made. It’s metal but the drain tray is a hard plastic , which is fantastic because then it won’t rust. I am all about making things in life easier and this sponge holder not only looks great , it will eliminate cleaning up messes off the side of the sink. I posted a picture with water running into the sponge holder and it shows how the water runs down into the sink… It holds various sizes of sponges. It’s got a little area for a brush .I have a couple of my smiley sponges ( no names mentioned ) that fit in there perfectly.. every kitchen should have one of these without a doubt!!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 18, 2026
A
Amazon Jane
Alexandria, US
★★★★★ 5
Adequate sponge organizer
Color: Black, Color: Black
This is a black matte metal sponge organizer. It does have a tilted drip tray so the water drips down into your sink. The metal is cheap but effective. For the price, the added organization you get from this item is worth it! Could also be used in a bathroom. There is no mounting hardware included, not even adhesives. The metal is already warped out of the box. This is not a high quality item, but the price is fair!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 23, 2026
L
Verified Purchase
Liz
Battle Creek, US
★★★★★ 5
Great dish soap, cloth and scrubbies organizer!
Color: Black, Size: with Dishcloth Holder, Color: Black, Size: with Dishcloth Holder
I love the fact that it holds all my tools for the dishes. It helps to keep the area tidy.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 9, 2026

recommand products