SKU: 32818431215

Human CY211, His Tag

Sale price$157.50 Regular price$175.00
Save 10%

Pay in installments of $43.75 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 31 - Sep 5

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CY211, His TagProduct Specification Species Human Synonyms Cy211 Accession P08727 Amino Acid Sequence Protein sequence(P08727, Ser239 Leu400 with C 10*His) SAPGTDLAKILSDMRSQYEVMAEQNRKDAEAWFTSRTEELNREVAGHTEQLQMSRSEVTDLRRTLQGLEIELQSQLSMKAALEDTLAETEARFGAQLAHIQALISGIEAQLGDVRADSERQNQEYQRLMDIKSRLEQEIATYRSLLEGQEDHYNNLSASKVLGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Theoretical: 20kDa Actual: 22kDa Purity 95% by SDS PAGE Endotoxin <1EU g Conjugation

Product Specification


Species Human
Synonyms Cy211
Accession P08727
Amino Acid Sequence

Protein sequence(P08727, Ser239-Leu400 with C-10*His)


SAPGTDLAKILSDMRSQYEVMAEQNRKDAEAWFTSRTEELNREVAGHTEQLQMSRSEVTDLRRTLQGLEIELQSQLSMKAALEDTLAETEARFGAQLAHIQALISGIEAQLGDVRADSERQNQEYQRLMDIKSRLEQEIATYRSLLEGQEDHYNNLSASKVLGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical: 20kDa Actual: 22kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 ℃ to -70 °C as supplied.

1 month, 2 to 8 °C under sterile conditions after reconstitution.  

Please avoid repeated freeze-thaw cycles. 

Background

Cytokeratin 19 fragment antigen (Cy211) belongs to a cytokeratin family, which is normally expressed in epithelial tissues and forms the epithelial cells’ filament cytoskeleton. Cy211 is useful as a tumor marker, especially for non-small cell lung cancer (NSCLC) along with carcinoembryonic antigen (CEA) and squamous cell carcinoma–associated antigen (SCC), but also for other epithelial tumors such as bladder cancer. This elevation in tumors may be due to cell lysis, releasing cell contents to the blood, including Cy211 by the action of proteases that degrade the cytokeratin filaments 

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 32818431215

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.9 ★★★★★
Based on 15 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Verified Purchase
Mel B
Charlottesville, US
★★★★★ 5
Just Wow
Format: Kindle
This book is the start of an amazing new supernatural romance series by KC Kean, and like all her other series, it is incredible! From the first page she sucks you in to the story and you just cannot put it down. She is such an amazing storyteller, you feel like you are right there in the world she is creating, and I love that about her writing. The FML, Raven,is a strong, badass character who can hold her own, but still has a soft spot for her men. And Holy wow what men they are. Lots of shared heat between them all that had my heart racing. Parts of this story had me literally tensing in anticipation of what may be coming next. Spice, danger, drama, mystery…the perfect package. I read it in less than a day, to my own detriment, because then I am left in suspense for the next book. I cannot wait for the next book. Highly recommend reading this!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 24, 2023
L
Verified Purchase
LBD
Carnegie, US
★★★★★ 5
New favorite
Format: Kindle
I have been working my way through KC Kean's series's and this is my new favorite! Raven is a magicless girl living in a wasteland. She is taken to a magical academy where nothing is as it seems, and her life is forever changed. This is an original story with characters you can't help but love or hate depending on who you are talking about. There were no slow parts, the steam is at a perfect level, and I can't wait to start the next book. Edit: Added after finishing the series. FYI Book 1 was AMAZING. Book 2 was not quite as good, but still worth reading. Books 3 and 4 really went downhill. If I had known, I don't know if I would have started the series.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 23, 2025
E
Verified Purchase
❈ Elizabeth ❈ | Breakawayreads
Belleville, US
★★★★★ 5
Fallen Angels, fae, vampires, oh my!
Format: Kindle
Rating: 4.5 | Spice: 2 (but a good slow-burn) • Main Characters: Huntyr and Wolf • I couldn’t wait to read this book; there was so much hype about it! And there was no doubt why. I fell in love with the characters and the plot itself. This book is mainly plot driven more than friction driven but it’s easy to follow along with. The characters are fun, easily understood. The main setting is at an academy where both the main characters are going through trials and building strength for the final test, The Transcendent. There are fantastic side characters as well. I loved the camaraderie between Huntyr and her friends. But we don’t like Lanson. 😆 We do have some plot twists that come into play throughout the book. Secrets and betrayal to be seen. I did adore Wolf and Huntyr’s relationship. It was a classic slow burn trope. They didn’t hit it off fast, but in time their feelings grew. I loved their banter, so sexy. Wolf is your next book boyfriend; Huntyr is your next vampire assassin independent bad-a*s female. Themes include loyalty, trust, self-discovery, a true slow burn romance. Side note: book ends on a angsty cliffhanger! • Emily, thank you for writing this awesome novel and I cannot wait to devour Book 2, Blood So Brutal! 😍 • Happy reading, my lovelies! xo
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 21, 2024
M
Verified Purchase
MelsABookworm
Pawtucket, US
★★★★★ 4
“My heart bows to you and you only, Huntress.”
Format: Kindle
3.5 🌟 This book popped up in my KU recommended reading suggestions and the synopsis sounded like what I was in the mood for. I'm so glad I took a chance on it. I went into this knowing absolutely nothing about it and ended up really liking it. I love when this happens. The main characters are likeable and I easily found myself rooting for them. There is a mystery element to each of their backstories that I enjoyed watching unfold and can't wait to get more of. Wolf, in particular, has me fixated. Love him. I found this to be an entertaining, addictive read with a plot that moves along at a good pace. It reads so easily I found myself very reluctant to put it down. Lots of twists and turns and the angst is there. A good set up for the next book to come, for sure. My issues with this book....the dialogue feels a bit juvenile at times and there is a repetitive over use of a particular word phrasing that I found myself giving the ole eye-roll to. There are, without a doubt, some pretty cliche moments that gave me a bit of the cringe. I think this could've certainly 100% benefited from more depth regarding the world building. Perhaps the world building was sacrificed to keep the pacing quick? Just a guess. Also, the lack of consistency of character for the FMC was really evident and so she feels quite illogical at times. Overall, this was a fun and enjoyable read that hit the spot well enough for me. That ending certainly has me impatiently pining for book 2!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 18, 2024
A
Verified Purchase
Amazon Customer
West Palm Beach, US
★★★★★ 3
Interesting take on the genre
Format: Kindle
True rating: 3.25 ⭐️ I enjoyed the fresh take on the genre. The best way I could describe the setting and world is an apocalyptic dystopian version of Farie where vampires, fae, and angles struggle to survive in what is left of the world. It was definitely interesting throwing the academy/hunger games aspect into this world as well. Even though I guessed the final reveal early on in the book, I kept hoping I was wrong, and it would take a surprising turn. While the "plot twists" were a bit predictable to me, I still enjoyed the ride this book took me on. Another downfall for me was the plot holes in the world building... I.E. if society has fallen and the world is in the aftermath of war, how are there trains running around the world? Just to take young adults to the trials to get into the golden city? How is the train maintained, the tracks clear, etc? However, I did enjoy the FMC & MMC and thought they were fleshed out nicely. I also enjoyed the side characters but wish some were developed more like Ashalin (sp?). I do find myself rooting for the MCs to succeed and find happiness together, which is obviously an important aspect for romantasy. Overall, was this an earth-shattering, mind-bending, terrific piece of literature? No. But was it the worst thing I've read this year? Also, no. This book has, to me, the bones of a great read & just needs a bit more to push it from an alright book to a great book. Overall ratings: Plot- 3.5⭐️ World building 3⭐️ Spice 2.5 🌶🌶 Main characters 4 ⭐️ Supporting characters 3.5⭐️
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 12, 2024

recommand products