SKU: 49834488302

Human CD16b, His tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 31 - Sep 5

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CD16b, His tagProduct Specification Species Human Synonyms Low affinity immunoglobulin gamma Fc region receptor III B, Fc gamma RIII beta, FcR 10, IgG Fc receptor III 1, FCGR3B, FCG3, FCGR3, IGFR3 Accession O75015 Amino Acid Sequence Protein sequence(O75015, Gly17 Ser200, with C 10*His)

Product Specification


Species Human
Synonyms Low affinity immunoglobulin gamma Fc region receptor III-B, Fc-gamma RIII-beta, FcR-10, IgG Fc receptor III-1, FCGR3B, FCG3, FCGR3, IGFR3
Accession O75015
Amino Acid Sequence Protein sequence(O75015, Gly17-Ser200, with C-10*His) GMRTEDLPKAVVFLEPQWYSVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVNDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKDRKYFHHNSDFHIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTISGGGGSHHHHHHHHHH
Expression System HEK293
Molecular Weight Theoretical:22.5kDa Actual:35-50kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage 12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

CD16, also known as FcγRIII, is a cluster of differentiation molecule found on the surface of natural killer cells, neutrophils, monocytes, macrophages, and certain T cells. CD16 has been identified as Fc receptors FcγRIIIa (CD16a) and FcγRIIIb (CD16b), which participate in signal transduction. The most well-researched membrane receptor implicated in triggering lysis by NK cells, CD16 is a molecule of the immunoglobulin superfamily (IgSF) involved in antibody-dependent cellular cytotoxicity (ADCC). It can be used to isolate populations of specific immune cells through fluorescent-activated cell sorting (FACS) or magnetic-activated cell sorting, using antibodies directed towards CD16.
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 49834488302

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 21 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Amit babbar
Draper, US
★★★★★ 5
The taste is amazing
Size: 2.1 Ounce (Pack of 1), Size: 2.1 Ounce (Pack of 1)
The creaminess and nuttiness is there and it is the best in a oatmilk matcha latte and the color is amazing and it is not a culinary grade it is ceremonial
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 2, 2026
R
Verified Purchase
Real Reviews
Birmingham, US
★★★★★ 5
Of good quality...
Size: 2.1 Ounce (Pack of 1)
I believe this matcha to be of good quality. However I am fairly new to Matcha in general. Yet I have tried a few different manufacturers. And this is best thusfar. A vibrant green and firm flavor. Foams properly with appropriate technique. Enjoy.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 2, 2026
A
Verified Purchase
Amazon Customer
Waukegan, US
★★★★★ 4
Decent Matcha! I Recommend!
Size: 2.1 Ounce (Pack of 1)
This is actually not bad, especially for the price! Great color, good taste. Larger size means a little more bang for your buck without sacrificing quality. I find this Matcha equal to others in the same price range but you get a little more. Of course it’s not the exquisite quality but if you are shopping for Matcha in this price range then it’s a great choice. Would buy again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 20, 2026
C
Verified Purchase
cece marie
Los Angeles, US
★★★★★ 5
Amazing quality and value
Size: 2.1 Ounce (Pack of 1)
This matcha is a great value. I find others in large packaging do not have the best taste, but smaller ones are often so expensive. This one tastes amazing and it's not going to break the bank, especially if you can get it on sale. It blends nicely when using a matcha whisk, and I love making iced protein matcha lattes with it!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 20, 2026
S
Verified Purchase
su
Birmingham, US
★★★★★ 5
Best budget friendly matcha
Size: 2.1 Ounce (Pack of 1), Size: 2.1 Ounce (Pack of 1)
I was skeptical, but it turned out to be very good for a budget friendly matcha. It was very smooth and wasnt gritty. Had a slight bitterness but not in an unbearable way. And did not have that strong grassy taste that alot of cheaper matchas have. I will definitely be repurchasing
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 24, 2026

recommand products