SKU: 54071054747

Human IL-6,His tag

Sale price$166.50 Regular price$185.00
Save 10%

Pay in installments of $46.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 31 - Sep 5

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human IL-6,His tagProduct Specification Species Human Synonyms B cell stimulatory factor 2 (BSF 2), CTL differentiation factor (CDF), Hybridoma growth factor, Interferon beta 2 (IFN beta 2),IFNB2 Accession P05231 Amino Acid Sequence Protein sequence(P05231, Val30 Met212, with C 10*His)

Product Specification


Species Human
Synonyms B-cell stimulatory factor 2 (BSF-2), CTL differentiation factor (CDF), Hybridoma growth factor, Interferon beta-2 (IFN-beta-2),IFNB2
Accession P05231
Amino Acid Sequence

Protein sequence(P05231, Val30-Met212, with C-10*His)
VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQMGGGGSHHHHHHHHHH

Expression System CHO
Molecular Weight

Theoretical:22.4kDa Actual:20-23kDa

Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Interleukin 6 (IL-6) is an interleukin that acts as both a pro-inflammatory cytokine and an anti-inflammatory myokine. In addition, osteoblasts secrete IL-6 to stimulate osteoclast formation. Smooth muscle cells in the tunica media of many blood vessels also produce IL-6 as a pro-inflammatory cytokine. IL-6's role as an anti-inflammatory myokine is mediated through its inhibitory effects on TNF-alpha and IL-1 and its activation of IL-1ra and IL-10. There is some early evidence that IL-6 can be used as an inflammatory marker for severe COVID-19 infection with poor prognosis, in the context of the wider coronavirus pandemic.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 54071054747

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 16 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
B
Verified Purchase
Bruce Belack
Alexandria, US
★★★★★ 5
Asurion gets 5 stars
Asurion tried to repair our printer. And when it was beyond repair they within 24 hours remitted an Amazon gift card enabling us to purchase a new printer we received in 2 days. I highly recommend Asurion.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 9, 2026
E
Verified Purchase
Elliott Brodzinski
Lowell, US
★★★★★ 5
Better to have then not!
Excellent when you need it! Prompt claim assistance.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 19, 2026
C
Verified Purchase
Customer
Fort Morgan, US
★★★★★ 5
Affordable protection plan and superb customer care
I usually don’t buy extended warranty, but I took a chance and added a 4-year Asurion Protection Plan to my purchase of a Canon PIXMA printer. So glad I did!! After only a year and a half, my printer showed an error message 6800. Cannon website states “Support code 6800 generally indicates a failure with the logic board on your printer. Service will be required.” How convenient for that to happen shortly out of Canon’s regular 1-year warranty (🙄). I called Canon. Long story short…they couldn’t do anything for me unless I purchase a warranty plan from them and they send me a replacement or I would need to pay for a repair. No thanks. I called Asurion and talked to a very nice tech support person. She couldn’t get rid of the error message remotely, so she transferred me to another very nice support specialist, who helped me start a repair claim. Asurion mailed me a box with a lot of packing material, along with shipping instructions and label to ship my printer to them for free. A few days into the repair process, they determined my Canon printer was unrepairable and they emailed me an Amazon gift card that same day for the cost of my crappy Canon printer. They were in total communication via email throughout the repair process. I highly recommend Asurion, and I would definitely purchase another protection plan from them again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 1, 2023
L
Verified Purchase
Luis Gutierrez
Louisville, US
★★★★★ 5
It's a must!!
Great service!! Assurion has been there each time I've experienced issues with my products. It's worth the cost.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 11, 2026
J
Verified Purchase
Jojanna
Birmingham, US
★★★★★ 5
Honesty and Integrity
Easy to work with, took care of the issue, highly recommend
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 31, 2026

recommand products