Pay in installments of $46.25 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 31 - Sep 5
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
Mouse NK1.1/CD161, His tagProduct Specification Species Mouse Synonyms Killer cell lectin like receptor subfamily B member 1C, CD161 antigen like family member C, Lymphocyte antigen 55c (Ly 55c), NKR P1. 9, NKR P1C, Natural killer cell surface protein P1 40 (NKR P1 40), Klrb1c Accession P27814 Amino Acid Sequence Protein sequence(P27814, Gln67 Ser223, with C 10*His)
Product Specification
| Species | Mouse |
| Synonyms | Killer cell lectin-like receptor subfamily B member 1C, CD161 antigen-like family member C, Lymphocyte antigen 55c (Ly-55c), NKR-P1.9, NKR-P1C, Natural killer cell surface protein P1-40 (NKR-P1 40), Klrb1c |
| Accession | P27814 |
| Amino Acid Sequence | Protein sequence(P27814, Gln67-Ser223, with C-10*His) QKPSREKCCVFIQENLNKTTDCSVNLECPQDWLLHRDKCFHVSQVSNTWEEGQADCGRKGATLLLIQDQEELRFLLDSIKEKYNSFWIGLRFTLPDMNWKWINGTTFNSDVLKITGVTENGSCASILGDKVTPESCASDNRWICQKELNHETPSNDSGGGGSHHHHHHHHHH |
| Expression System | CHO |
| Molecular Weight | Theoretical:19.6kDa Actual:28kDa |
| Purity | ＞90% by SDS-PAGE |
| Endotoxin | <1EU/μg |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4. |
| Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
| Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles. |
Background
CD161 is one of the earliest markers expressed during NK cell maturation from CD34+ hematopoietic stem cell precursors. Expression of CD161 correlates with the cytotoxic function of CD16+ NK cells, and ligation of CD161 with its ligand LLT1 inhibits NK cell cytotoxicity and cytokine secretion. CD161 is expressed early in NK cell development, where it may facilitate cross-talk of NK cell precursors with cells within the bone marrow, and is involved in CXCL8 release. Within the periphery, cross-linking of CD161 leads to an increase in IFNγ expression and inhibition of NK cell cytotoxicity. There have been various reports of modulated expression of CD161 on NK cells during viral infections. For instance, reduced CD161 expression in acute hepatitis C virus (HCV) infection predicted viral clearance, and correlated with increased liver inflammation in chronic HCV infection. Patients with chronic human immunodeficiency virus (HIV) infection have depleted CD161+ NK cells compared to healthy donors.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy