Pay in installments of $25.00 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 31 - Sep 5
For Your Every Summer RSVP, with Code: SUMMER15
Description
Human ATRX , His tagProduct Specification Species Human Synonyms Transcriptional regulator ATRX, ATP dependent helicase ATRX, X linked helicase II, X linked nuclear protein (XNP), Znf HX, RAD54L, XH2 Accession P46100 Amino Acid Sequence Protein sequence(P46100, Gly2250 Asn2450, with C 10*His)
Product Specification
| Species | Human |
| Synonyms | Transcriptional regulator ATRX, ATP-dependent helicase ATRX, X-linked helicase II, X-linked nuclear protein (XNP), Znf-HX, RAD54L, XH2 |
| Accession | P46100 |
| Amino Acid Sequence | Protein sequence(P46100, Gly2250-Asn2450, with C-10*His) MGYHEHDSLLDHKEEEELTEEERKAAWAEYEAEKKGLTMRFNIPTGTNLPPVSFNSQTPYIPFNLGALSAMSNQQLEDLINQGREKVVEATNSVTAVRIQPLEDIISAVWKENMNLSEAQVQALALSRQASQELDVKRREAIYNDVLTKQQMLISCVQRILMNRRLQQQYNQQQQQQMTYQQATLGHLMMPKPPNLIMNPSNGGGGSHHHHHHHHHH |
| Expression System | E.coli |
| Molecular Weight | Theoretical:24.9kDa Actual:27kDa |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <1EU/μg |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4. |
| Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
| Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles. |
Background
Transcriptional regulator ATRX also known as ATP-dependent helicase ATRX, X-linked helicase II, or X-linked nuclear protein (XNP) is a protein that in humans is encoded by the ATRX gene. It contains an ATPase / helicase domain, and thus it belongs to the SWI/SNF family of chromatin remodeling proteins. ATRX is required for deposition of the histone variant H3.3 at telomeres and other genomic repeats. These interactions are important for maintaining silencing at these sites. Acquired mutations in ATRX have been reported in a number of human cancers including pancreatic neuroendocrine tumours, gliomas, astrocytomas, osteosarcomas, and malignant pheochromocytomas. There is a strong correlation between ATRX mutations and an Alternative Lengthening of Telomeres (ALT) phenotype in cancers.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.4 ★★★★★
Based on 29 reviews
Sort
Product Reviews
★★★★★ 5
Essential USB-C Adapters That Just Work Perfectly
These adapters are an absolute must-have and make life significantly easier when dealing with modern USB-C devices.
The fit is perfect, the adapters feel high quality, and they work flawlessly. Data transfer has been fast and reliable, and I have had no connectivity issues at all.
They are small enough to keep permanently attached to cables or stored in a laptop bag, making them incredibly convenient for everyday use.
As someone who regularly works with laptops, electronics, and multiple USB standards, I consider these essential accessories. They offer excellent value for the money and solve a surprisingly common problem very elegantly.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 27, 2026
★★★★★ 5
Works perfectly with MacBook
Bought these adapters after getting a wireless mouse for a MacBook and realizing the USB receiver couldn’t be connected directly because the Mac doesn’t have a regular USB port. These adapters solved the problem completely.
They work exactly as expected and were very easy to use. The quality feels good and the color matches the MacBook nicely, so they don’t look cheap or out of place. Small, simple, and stylish adapters that do their job well
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 16, 2026
★★★★★ 5
Anker adapters
These Anker adapters honestly saved me. The quality feels very premium and they work perfectly with no disconnecting or recognition issues. I used them to connect USB-C accessories and everything worked instantly and smoothly.
They’re compact, durable, and super convenient to carry around for my content creation setup. The metallic finish also feels much more reliable compared to cheaper adapters I’ve tried before.
Definitely recommend this brand if you want something dependable and high quality for your devices. ✨
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 25, 2026
★★★★★ 5
Very Well-Made and Works Great!
I have a Macbook Pro, and naturally, these computers don't come with USB ports to connect to. That's why I bought these adapters. I needed some high quality ones that I know will last me for a long time, and given that I own my Anker products, I figured these would be a great purchase.
And they are! These adapters are very well built. There's a bit of heft to them, and they feel very stable when plugged into my computer. There's no noise or distraction coming from them. You just plug it in and that's it. I have never once had any connectivity issues where the adapter, for whatever reason, stops working and I have to unplug it and then plug it back it. No, it works straight from the box and hasn't given me any issues.
These are great adapters because they're built very sturdy, will not cause any connectivity issues, and are nice if you want to use a mouse or connect a USB stick to your Macbook.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 18, 2026
★★★★★ 5
Simple Solution for Using USB-A Cables with USB-C Chargers
I used these for the first time last week when I needed to plug a USB-A cable into a newer USB-C charger.
They worked exactly as expected. The connection was solid, and the device powered on without any issues.
I’ve generally had good experiences with Anker products, and these adapters are consistent with that—simple and reliable for what they’re designed to do.
These are useful for bridging older USB-A cables with newer USB-C power sources, especially for basic charging needs.
Build quality feels solid for the size, and they’re small enough to keep with your cables without getting in the way.
Overall: a straightforward and reliable adapter for using USB-A cables with USB-C chargers.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 1, 2026
recommand products
AC300 Accoson Examination Light, AC300 Accoson Examination Light
380.50
LSFSF312BT - 312 Litre Freestanding Freezer
775.00
Welch Allyn 3.5V Diagnostic Set - Coaxial LED Ophthalmoscope, Basic LED Otoscope, Alkaline C-Cell Battery Handle and Hard Case - CLEARANCE
192.50
Advanced Clutch XACT Flywheel Streetlite for BMW 135i/335i/335xi/535i (601180)
472.00
Advanced Clutch HD/Race Sprung 6 Pad Kit (NX9-HDG6)
260.00