SKU: 51009053243

SARS-CoV-2 (BQ.1.1/Omicron) RBD, His tag

Sale price$121.50 Regular price$135.00
Save 10%

Pay in installments of $33.75 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 1 - Sep 6

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

SARS-CoV-2 (BQ.1.1/Omicron) RBD, His tagProduct Specification Species SARS CoV 2 Accession P0DTC2 Amino Acid Sequence Protein sequence(P0DTC2, Arg319 Lys537, with C 10*His) RVQPTESIVRFPNITNLCPFDEVFNATTFASVYAWNRKRISNCVADYSVLYNFAPFFAFKCYGVSPTKLNDLCFTNVYADSFVIRGNEVSQIAPGQTGNIADYNYKLPDDFTGCVIAWNSNKLDSTVGGNYNYRYRLFRKSKLKPFERDISTEIYQAGNKPCNGVAGVNCYFPLQSYGFRPTYGVGHQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Theoretical: 26. 3kDa Actual: 33kDa Purity

Product Specification


Species SARS-CoV-2
Accession P0DTC2
Amino Acid Sequence

Protein sequence(P0DTC2, Arg319-Lys537, with C-10*His)
RVQPTESIVRFPNITNLCPFDEVFNATTFASVYAWNRKRISNCVADYSVLYNFAPFFAFKCYGVSPTKLNDLCFTNVYADSFVIRGNEVSQIAPGQTGNIADYNYKLPDDFTGCVIAWNSNKLDSTVGGNYNYRYRLFRKSKLKPFERDISTEIYQAGNKPCNGVAGVNCYFPLQSYGFRPTYGVGHQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical: 26.3kDa Actual: 33kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 ℃ to -70 °C as supplied.

1 month, 2 to 8 °C under sterile conditions after reconstitution.  

Please avoid repeated freeze-thaw cycles. 

Background

Sars-cov-2 (2019-NCOV) infects human respiratory epithelial cells through binding to human ACE2 receptors. Spike protein is a large type I transmembrane protein containing two subunits S1 and S2.S1 mainly contains a receptor binding domain (RBD), which is responsible for recognizing cell surface receptors. S2 contains the basic elements required for membrane fusion. S protein plays a key role in inducing neutralizing antibody and T cell responses as well as protective immunity.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 51009053243

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 9 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
R
Verified Purchase
R.L.
Dallas, US
★★★★★ 5
Absolutely Delightful and an Old Friend
Format: Kindle
I’ve always loved Cinderella stories; ever since I was a little girl. I’d never heard of this book until the movie came out when I was in college. I decided to buy the movie as I had liked Anne Hathaway in Princess Diaries. The first time I watched it was with my cousin who was actually teaching the book in her middle school class and was very curious about the movie. At first I really like the movie. My cousin assured me that the book was better but that’s usually the case so I didn’t pay too much attention. Finally I checked the book out of the library. I began to read and was hooked from the beginning. I knew just a few pages in that Ella Enchanted (the book) and I were going to be great friends, in other words, I knew I’d be reading it over and over again. I went out and bought my own copy before I even finished reading the library’s copy. I still have that book now about 17 years later and have read it many times. Because of declining health I’ve had to recently start reading my books on Kindle. I don’t have the strength to hold up an actual book. Today, I bought a Kindle version of Ella Enchanted so I can have my old friend back. After I’d read the book, I realized how much the movie had destroyed the story. I ended trading it in at some store that did trades for the DVD of Spider Man. They added a ruthless, super-villain in the movie when she already had a stepmother and stepsisters who were willing to order her about. Her father as I recall was simply absent. He’d left instructions for his new wife to treat his daughter as she would her own which she thoroughly ignored, but, in the end it was Ella’s own strength that sets her free, which I think is something very important for young girls to learn to be strong in their own right. I’m looking forward to catching up with an old friend again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 4, 2022
N
Verified Purchase
NewGenesis
Chelsea, US
★★★★★ 4
Good But Could Be Better
Format: Paperback
First, the good things about this book: I picked up the book after seeing the movie only to find that they were somewhat different, which isn't necessarily a bad thing. To start off, I loved the idea of having Ella being cursed to obey every command. It was the question I asked the first time I read the fairytale, "Why did she always do what her stepmother said?" And that question was thoroughly answered in this novel. I liked the character of Ella and her rebellious spirit. Levine definitely presented to us a new and different take on Cinderella, one much more spirited than the ridiculously innocent and proper Cinderella we are accustomed to. I especially liked her bravery, a surprising characteristic in the female protagonist of a romance novel, and how she was able to save herself from danger instead having prince Charmont save her. Speaking of the prince, I'm surprised to say I liked him in spite of hating practically all other "re-invented" versions of Prince Charming in every other princess story. Charmont was charming without being brash or flirtatious; he was honest, steady, and true to his word, without being a cliched knight in shining armor. I enjoyed watching the blooming friendship and eventually romance between Char and Ella; the character development was more than I expected and added depth to the story. I also rather enjoyed the "villians" of the story in the forms of Olga, Ella's father Sir Peter, Hattie, and Olive. Though they are easy to hate in the traditional fairy tale, they are even more despicable in the book. SPOILER ALERT AHEAD. One of the things I liked most about this book was that Lucinda, Ella's fairy godmother, got a taste of her own medicine, which I feel the book needed (though this was not included in the movie). However, one thing I felt the book needed towards the end of the story was an assassination plot to kill Prince Char. After Char proposes, Ella feels she can't marry him because someone would use her to kill him or some how ruin the kingdom. At the time there doesn't seem to be any such danger present, considering her step-family adores him and the entire kingdom loves him. I felt a plot to kill the prince, such as in the movie, would be the perfect danger to round out the last third of the novel and add some excitement and a legitimate reason for Ella to lie to Char about her feelings. The only other thing that really bothered me was the mention of Angulen's pottery. It is stated that his works are very valuable and of much importance, and the novel puts much influence on them, yet they have absolutely nothing to do with the plot in any way. Overall, it is a good book for those within it's target demographic. With a fiery Cinderella and prince who actually is charming, I feel this is a good retelling of the classic Cinderella story.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 31, 2012
R
Verified Purchase
Reading Rainbow Trout
Fort Morgan, US
★★★★★ 5
Better than the movie
Format: Kindle
I really loved this book. The Disney movie was clearly only very loosely based on this wonderful story. I’m actually kinda mad I ever saw the movie because it kept me from the book for so long.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 16, 2025
K
Verified Purchase
Kikyo C.
Cuba, US
★★★★★ 5
A fairytale classic made even better!
Format: Paperback
Embellishing on the original tale of Cinderella, Gail Levine has written an imaginative and touching story - a classic in its own right. While the traditional fairytale focuses on the magical rags-to-riches transformation of a scullery maid into a princess, Levine's heroine is very real in both her defeats and her triumphs. Ella is a wonderful character whose unwavering sense of humor and refusal to succumb make her an endearing heroine whom the reader eagerly follows through her journeys. The friendship that she shares with Prince Char, her struggles to break the curse placed on her at birth, the pain and the joy that she feels at each turn of events are drawn with a clarity and poignant charm that make this a unique story all its own. There is, of course, glass slippers, a ball, the pumpkin coach - but this story goes far beyond the original to become something more. It is not just about one magical night that makes a servant into a princess; it is about the life of a girl who is more than what she seems and has only to realize it for herself to make her wishes come true. Ella Enchanted is a wonderful story for readers of all ages, and there is an amazing depth to this tale that cannot help but make you think. Despite the omnipresent existence of magic and the whimsical creatures that include everything from gnomes and elves to giants and ogres, the focus of the story is very real. We are, each of us, a little bit like Ella - struggling to be who we are while everything around us tries to make us otherwise. I strongly recommend this book to anyone who loves fairytales and children's books - especially to anyone who loves the story of Cinderella.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 18, 2000
J
Verified Purchase
Jacqueline Cortez
Boise, US
★★★★★ 5
Timeless
Format: Hardcover
My first born daughter is literally named Ella after Ella Enchanted. This is the most meaningful children’s book I ever experienced in childhood and it continues to hold up as I have reread it to my Ella in parenthood. It’s still so fun and magical and heartfelt. Thank you Gail Carson Levine for this literary gem!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 25, 2025

recommand products