SKU: 61564828387

Human ST2, His tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 1 - Sep 6

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human ST2, His tagProduct Specification Species Human Synonyms sST2, Interleukin 1 receptor like 1 Accession Q01638 Amino Acid Sequence Protein sequence(Q01638, Lys19 Ser328, with C 10*His)

Product Specification


Species Human
Synonyms sST2, Interleukin-1 receptor-like 1
Accession Q01638
Amino Acid Sequence

Protein sequence(Q01638, Lys19-Ser328, with C-10*His) KFSKQSWGLENEALIVRCPRQGKPSYTVDWYYSQTNKSIPTQERNRVFASGQLLKFLPAAVADSGIYTCIVRSPTFNRTGYANVTIYKKQSDCNVPDYLMYSTVSGSEKNSKIYCPTIDLYNWTAPLEWFKNCQALQGSRYRAHKSFLVIDNVMTEDAGDYTCKFIHNENGANYSVTATRSFTVKDEQGFSLFPVIGAPAQNEIKEVEIGKNANLTCSACFGKGTQFLAAVLWQLNGTKITDFGEPRIQQEEGQNQSFSNGLACLDMVLRIADVKEEDLLLQYDCLALNLHGLRRHTVRLSRKNPIDHHSGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical:36.6kDa Actual:55-70kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

The ST2 cardiac biomarker (also known as soluble interleukin 1 receptor-like 1) is a protein biomarker of cardiac stress encoded by the IL1RL1 gene. ST2 signals the presence and severity of adverse cardiac remodeling and tissue fibrosis, which occurs in response to myocardial infarction, acute coronary syndrome, or worsening heart failure. ST2 provides prognostic information that is independent of other cardiac biomarkers such as BNP, NT-proBNP, highly sensitive troponin, GDF-15, and galectin-3. One study indicated that discrimination is independent of age, body mass index, history of heart failure, anemia and impaired kidney function or sex.sST2(Soluble ST2) is a biomarker for risk stratification in patients with heart failure (HF) and prognostic assessment. Compared with BNP and NT-proBNP, ST2 is not affected by age, factors such as BMI and renal insufficiency.Different with so many other heart markers, the level of ST2 varies rapidly with the patient's condition. This means that ST2 can help clinicians respond faster. The increase of sST2 level (> 35ng/ml) was highly correlated with the severity of heart failure which can be used to predict readmission and mortality.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 61564828387

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 30 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
John
Birmingham, US
★★★★★ 4
Great except for one small flaw
Color: Regular - Beak, Color: Regular - Beak
Our dog likes to get at the juicy innards of every toy we buy him. We tried this one as it promised to be "bullet proof". It lasted about a week which in fairness is 6.5 days longer than most of the toys we buy last. He ripped off the wings which was to be expected and not an issue. It took him another 6 days to finally locate a weak point and break in. It appears that the tag is not made of kevlar but merely sewed on. I guess it would be better if they had just sewed it on top but they made it part of the overall structural integrity. This provided a small area of weakness which our dog located and proceeded to exploit. It's like having the death star but installing a small thermal exhaust port that allows for access to the very core of the station. Makes little sense. Overall I am pleased with the overall sturdiness but in the end this toy had a small design flaw that my dog was able to locate and exploit in his neverending quest to gain access to and eat polyester fiber stuffing
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 6, 2026
K
Verified Purchase
Kym Brunner
Draper, US
★★★★★ 5
STRONG AS A MONSTER (albeit a cute one)
Color: Large - Billy the Beast Monster, Color: Large - Billy the Beast Monster
My aggressive chewer ate the adorable monster's ear off on the first day, but who cares? The body of the monster has been indestructible so far (one week). My 7 month old pup cbews it for a good 10-15 minutes at a time several times per day. Great quality product and outlasting all the other toys I bought (which she destroyed in 10 minutes - even the ones rated "Level 4 toughness" from Walmart. I think it's hilarious in my photo that the monster's expression perfectly shows his disappointment about missing an ear, LOL.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 3, 2026
L
Verified Purchase
Lorene
Boise, US
★★★★★ 5
King has met his match.
Color: Large - Billy the Beast Monster
I received my dog's toy this evening when I place the toy on the ground my dog King went crazy. He is a one-year-old Pitbull and love to tackle any toy he believes he can't take down, but Mr King has met his match with this toy. He was using all of his bite force to demolish the toy but the toy actually has worn him out. He ran around my yard for about 30 minutes with the toy in his mouth producing the squeaking sound from the toy as well. Hold up the toy is totally filthy with dirt almost covering the entire green and yellow belly of the toy. I have brought king mini toys in the last couple of months and this is the best toy that holds up to his energy level. I tried to retrieve the toy and place it in his dog house because it is far beyond his bedtime, but he wanted to play catch me if You can with my new toy. This is a great toy for those big energetic dogs that love to take their aggression out on maybe some furniture or perhaps that favorite shoe you do not want them to chew on. I am totally sold on this toy I brought from the seller who placed the items on the Amazon site. I plan on purchasing a another toy from the buyer to keep King energy at a low level if I can. I just checked on my dog and he actually has taken the toy with him inside of his dog house and now the toy is snugged under his left paw. I'm one of those smart owners I'm not going to even try to take it from him tonight but hopefully in the next week I can sneak it from him and it may be perhaps wash it. I did this item AA Plus
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 31, 2026
B
Verified Purchase
BBarry
Battle Creek, US
★★★★★ 3
Cute, but not Maligator-proof!
Color: Small - Towering Timmy Monster, Color: Small - Towering Timmy Monster
Fun toy while it lasts. My Belgian Malinois made quick work of this little guy but still enjoys playing with its carcass. Bite Force* but not taking into account the bite force of a Mali-gator!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 7, 2026
S
Verified Purchase
Steffyt
Waukegan, US
★★★★★ 5
Puppy Love
Color: Small - the Goofy Monster, Color: Small - the Goofy Monster
Short backstory.... My daughter moved in with her 3 dogs recently and brought her dogs toys. Over the course of the last 3 months, my dogs have managed to steal every last toy they could find. fast forward to purchasing this Blue Monster. It came today and was immediately grabbed by one of my dogs. She refused to give it up even for her favorite ball. Ten minutes later another dog had the baby monster and was not giving it up!!!! (think growling) I thought that I would put the monster up for the night to allow for some sleep but it felt like it had been soaked in slobber ( I am sure I saw it drip ;) ). My dogs seems to think this little blue monster is their one true love. Now for some facts. 1. Baby monster is quite small in comparison to my other Bite Force dog toys. It is not too small for my dogs but it is definitely not a size I would give to my daughters Pit that thinks she is a vacuum. 2. Squeaker lasted about 2 minutes before my dog drool invaded it. Currently no squeaky sounds can be heard...just slightly squishy sounds 3. No holes despite my dogs trying. There has been constant chewing (by Standard Poodles) on this little guy for the last 5 hours and not one little open area. Trust me this is a huge accomplishment. Stuffies last 10 seconds in this house. If you need a toy that will last longer than most I highly recommend Bite Force. The are designed for tough chewers and take a beating
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 11, 2025

recommand products