Pay in installments of $25.00 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Sep 1 - Sep 6
For Your Every Summer RSVP, with Code: SUMMER15
Description
Human GZMB , His tagProduct Specification Species Human Synonyms C11, CTLA 1, Cathepsin G like 1 (CTSGL1), Cytotoxic T lymphocyte proteinase 2 (Lymphocyte protease), Fragmentin 2, Granzyme 2, Human lymphocyte protein (HLP), SECT, T cell serine protease 1 3E, CGL1, CSPB, GRB Accession P10144 Amino Acid Sequence Protein sequence(P10144, Gly19 Tyr247, with C 10*His)
Product Specification
| Species | Human |
| Synonyms | C11, CTLA-1, Cathepsin G-like 1 (CTSGL1), Cytotoxic T-lymphocyte proteinase 2 (Lymphocyte protease), Fragmentin-2, Granzyme-2, Human lymphocyte protein (HLP), SECT, T-cell serine protease 1-3E, CGL1, CSPB, GRB |
| Accession | P10144 |
| Amino Acid Sequence | Protein sequence(P10144, Gly19-Tyr247, with C-10*His) GEIIGGHEAKPHSRPYMAYLMIWDQKSLKRCGGFLIRDDFVLTAAHCWGSSINVTLGAHNIKEQEPTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKRTRAVQPLRLPSNKAQVKPGQTCSVAGWGQTAPLGKHSHTLQEVKMTVQEDRKCESDLRHYYDSTIELCVGDPEIKKTSFKGDSGGPLVCNKVAQGIVSYGRNNGMPPRACTKVSSFVHWIKKTMKRYGGGGSHHHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | Theoretical:27.4kDa Actual:33kDa |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <1EU/μg |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, 1mM EDTA, pH7.4. |
| Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
| Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles. |
Background
Granzyme B (GZMB) is one of the serine protease granzymes most commonly found in the granules of natural killer cells (NK cells) and cytotoxic T cells. It is secreted by these cells along with the pore forming protein perforin to mediate apoptosis in target cells.Granzyme B has also been found to be produced by a wide range of non-cytotoxic cells ranging from basophils and mast cells to smooth muscle cells. The secondary functions of granzyme B are also numerous. Granzyme B has shown to be involved in inducing inflammation by stimulating cytokine release and is also involved in extracellular matrix remodelling.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.2 ★★★★★
Based on 11 reviews
Sort
Product Reviews
★★★★★ 5
Must get!, Great interaction, mind stimulation
Color: Orange
Love this my pup can't get enough. My pup loves this and is hard on it. She throws it all around chases it and guards it like it is her child. It is strong, sturdy easy to charge and fun to watch her engage with it.
Definitely must have and I will buy more. It shakes and rolls around, it walks itself and engages the pup to chase. The design is spectacular. It is light weight and the noise level is typical of a toy engaging response.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 22, 2026
★★★★★ 5
This is a great ball for high energy dogs.
Color: Blue
I have a Belgian Malinois, so you can imagine the Maligator jaws. Just opened this today and let her play with it indoors. She LOVES IT. It wore her out and it’s a toy she can really stay focused on without needing me to throw or roll for her. It moves on its own! I supervised her play. I was hoping it was too big to get under the couch, but no. It goes right under it. I had to block off the gap so I didn’t have to keep getting it out from under for her. The outter “shell” is very durable! When she had resting moments, she chewed it pretty good - I could hear the material squeaking against her teeth. I was worried she was tearing it up, but nope! Not a mark on it. It’s easy to set up and operate. It needed charging before play. After hours of play, she was able to somehow unscrew the outter shell. This concerned me bc the smaller, inner ball mechanism came out but I saw it right away and was able to put it back together. So, make sure it’s screwed together tightly (which I thought I had done without breaking it) and check it from time to time to make sure it hasn’t loosened. This is a great ball for her incredible high energy drive. It gives her the work and fun play she needs to get tired, which I love. This toy is on the expensive end, but so far it’s worth it. Now we’ll see how long it lasts!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 7, 2025
★★★★★ 5
Love love it
Color: Blue
Best dog toy ever. I have a 1 year old boxer who is full of energy (understatement). This ball has provided more entertainment for us both than any dog toy I’ve ever purchased. Charge holds well and has a very resilient shell. I love it. Worth the price.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 23, 2026
★★★★★ 4
Great ball for limited entertainment. Replaceable outer shell is an amazing option!
Color: Blue, Color: Blue
Bought this for our 45lb, ball-obsessed Dutch shepherd/pit bull dog mix. I had one of these years ago with the hard shell and couldn’t be happier with the new foam shell.
The new foam shell is much quieter and while our dog might put holes in it with his teeth, he doesn’t seem to ever pull pieces off.
For engagement level, he found it VERY interesting at first and was scared to grab it, but once he got over that he started holding it in his mouth even when it shakes and just tries to keep it.
Isn’t the best for fetch or anything as he has trouble letting it go when it is actively moving, but it makes him happy while he has it. We just make sure to monitor him while it is out.
The ability to change the outer shell and just buy a replacement for the shell instead of a whole new toy is a lovely feature that makes me very happy to continue buying from this company.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 19, 2026
★★★★★ 5
Great Interactive Option
Color: Blue
To start, I have been very happy with this purchase. A couple of key points for me are durability and being able to keep my dog's attention. I have had it for almost a year, just a month shy, and she hasn't managed to get through the foam outer shell even though she tries real hard to do so. Let's just say, she's hard to find toys for because of her habit of finding the point of failure where she can pick and gnaw at until the toy is no longer safe for her to have. With this toy, she not only found her match, but it also has her watching, waiting, and even stalking. Only one small issue has recently occurred: the motor has started having an issue where the charge doesn't hold, and it doesn't remain on afterwards. I have reached out to Cheerble directly to see about replacing it since I am still within their 12-month timeframe, and they responded right away.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 22, 2026