SKU: 83907733767

Human Thrombopoietin, His tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 30 - Sep 4

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human Thrombopoietin, His tagProduct Specification Species Human Synonyms C mpl ligand (ML), Megakaryocyte colony stimulating factor, Megakaryocyte growth and development factor (MGDF), Myeloproliferative leukemia virus oncogene ligand, THPO, MGDF Accession P40225 Amino Acid Sequence Protein sequence(P40225, Ser22 Gly353, with C 10*His)

Product Specification


Species Human
Synonyms C-mpl ligand (ML), Megakaryocyte colony-stimulating factor, Megakaryocyte growth and development factor (MGDF), Myeloproliferative leukemia virus oncogene ligand, THPO, MGDF
Accession P40225
Amino Acid Sequence

Protein sequence(P40225, Ser22-Gly353, with C-10*His) SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLKWQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHELLNGTRGLFPGPSRRTLGAPDISSGTSDTGSLPPNLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTSPLLNTSYTHSQNLSQEGGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight

Theoretical:37.1kDa Actual:75-90kDa

Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months,

-20 to -70 °C under sterile conditions after reconstitution.

1 week, 2 to 8 °C under sterile conditions after reconstitution.

Please avoid repeated freeze-thaw cycles.

Background

Thrombopoietin (THPO) also known as megakaryocyte growth and development factor (MGDF) is a protein that in humans is encoded by the THPO gene. Thrombopoietin is a glycoprotein hormone produced by the liver and kidney which regulates the production of platelets. It stimulates the production and differentiation of megakaryocytes, the bone marrow cells that bud off large numbers of platelets. Megakaryocytopoiesis is the cellular development process that leads to platelet production. Thrombopoietin is a humoral growth factor necessary for megakaryocyte proliferation and maturation, as well as for thrombopoiesis.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 83907733767

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 11 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
C
Verified Purchase
cheyP
Waukegan, US
★★★★★ 4
Truth
Scent: Unscented, Size: 4 Ounce (Pack of 2)
I have used this product for just 4 days now. This will be good and bad. A good all natural soap is not going to sud up like other soaps, I was shocked when I read some of the reviews and suds or the lack of suds seemed to be a big issue. This soap has very little suds. Another issue was smell. I do not notice any smell at all, the next time I order this product I would like to try the lemon for a little sent. This bar will last a long time, a little really gos along way. I do not notice any dryness but my skins feels tighter which makes me think it’s dry. I use my favorite body lotion and all is good. After the first use my skin was noticeably brighter. I had a pimple on my chin that was forming. I left the soap on my face for about 1 min. The next morning the pimple was nearly gone day two completely gone. I use a face cream called Just Tallow and combined with this soap it’s a perfect match. Tonight I put some soap on my feet and scrubbed them with a pumice stone and my feet are so soft right now. This is a good product and I will order again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 4, 2024
J
Verified Purchase
Jesse
Phoenix, US
★★★★★ 5
SMELLS AMAZING
The smell literally lasts all day and it smells so good. Seems to do very well as far as skin sensitivity.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 2, 2026
K
Verified Purchase
Kevin
Draper, US
★★★★★ 3
Good but not so good
Scent: Mineral Pool, Size: 4.5 Ounce (Pack of 2)
Good soap. If you have sensitive skin or cuts on your hands, it will irritate them. I bought 3 different scents and all 3 made gave my hands inflammation. I really like the smell of them. They make my hands feel soft.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 13, 2025
M
Verified Purchase
Mim
Alexandria, US
★★★★★ 5
Skin is clean and clear
Scent: Unscented, Size: 4 Ounce (Pack of 6)
I love this tallow soap, highly recommend. I had been making my own soap for a few years but the processes was time consuming, found this tallow soap for a reasonable price and am very happy with it! My skin is clean and clear. No weird smells for the tallow, and good size bars that last us awhile.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 24, 2026
R
Verified Purchase
rachel gascoyne
Draper, US
★★★★★ 5
Great natural soap!!!
Scent: Unscented, Size: 5 Ounce (Pack of 3), Scent: Unscented, Size: 5 Ounce (Pack of 3)
I LOVE this soap! It’s only two ingredients, probably the only one on the market that is so simple yet cleans effectively. My skin felt great after, it wasn’t drying and felt very gentle and lathered well. I’ve been using dove sensitive bar soap for years and could not find a natural soap that didn’t irritate my skin from essential oils. I used this after a day of roller blading outside on a hot day and it stood the test to clean well!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 17, 2026

recommand products