SKU: 91511261901

Human RUNX1, His tag

Sale price$40.50 Regular price$45.00
Save 10%

Pay in installments of $11.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 1 - Sep 6

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human RUNX1, His tagProduct Specification Species Human Synonyms Acute myeloid leukemia 1 protein, Core binding factor subunit alpha 2 (CBF alpha 2), Oncogene AML 1,PEA2 alpha B,PEBP2 alpha B, SL3 3 enhancer factor 1 alpha B subunit, SL3 AKV core binding factor alpha B subunit, AML1, CBFA2 Accession Q01196 Amino Acid Sequence Protein sequence(Q01196 Ser50 Leu183, with C 10*His)

Product Specification


Species Human
Synonyms Acute myeloid leukemia 1 protein, Core-binding factor subunit alpha-2 (CBF-alpha-2), Oncogene AML-1,PEA2-alpha B,PEBP2-alpha B, SL3-3 enhancer factor 1 alpha B subunit, SL3/AKV core-binding factor alpha B subunit, AML1, CBFA2
Accession Q01196
Amino Acid Sequence

Protein sequence(Q01196 Ser50-Leu183, with C-10*His)
SMVEVLADHPGELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRRHRQKLGGGGSHHHHHHHHHH

Expression System E.coli
Molecular Weight Theoretical:16.7kDa Actual: 17kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, 1mM EDTA, 1mM DTT, pH7.4. Normally trehalose is added as protectant before lyophilization.
Reconstitution Reconstitute no more than 0.1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

· 12 months from date of receipt, -20 to -70 °C as supplied. 
· 6 months, -20 to -70 °C under sterile conditions after reconstitution.
· 1 week, 2 to 8 °C under sterile conditions after reconstitution.  
· Please avoid repeated freeze-thaw cycles.

Background

Runt-related transcription factor 1 (RUNX1) also known as acute myeloid leukemia 1 protein (AML1) or core-binding factor subunit alpha-2 (CBFA2) is a protein that in humans is encoded by the RUNX1 gene. RUNX1 is a transcription factor that regulates the differentiation of hematopoietic stem cells into mature blood cells. In addition it plays a major role in the development of the neurons that transmit pain. It belongs to the Runt-related transcription factor (RUNX) family of genes which are also called core binding factor-α (CBFα). RUNX proteins form a heterodimeric complex with CBFβ which confers increased DNA binding and stability to the complex.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 91511261901

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 7 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
K
K
Chelsea, US
★★★★★ 5
easy to put together, stable and blocks out unwanted eyes.
Size: 88''W-4 Panel, Color: Grey
If you live in a high rise building, or where there is lots of foot traffic and can see in your windows, this is a must have. It's portable, can fold down one or two walls and easy to move around. Put together once, and block out light and eyes while tall enough to see over. You can fold it up along the wall, and use it to block out the blinds or light when using a projector so that it's darker. You can use it to partician the room if you share one, and separate your pile of junk from your room so you don't look at it, can take quite a bit of towel weight and clothes and doesn't tip over. Sturdy bottom metal and easy to put together. I got the grey one, and glad I did. I use it everyday and is part of my room decor. I love it, and after using it for a few months it's quite durable. The quality is there for sure. A tad pricey, but worth it. Must have for a private person.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 28, 2026
K
KKat 10
Port Orchard, US
★★★★★ 5
Well made dividers.
Size: 88''W-4 Panel, Color: Grey
Very durable and stable. Once positioned, they stay upright and firm and don't wobble around. Good materials on both the panels and the frame that supports it. Great for any partitioning needs and a fair price for the quality you receive. Highly recommended.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 28, 2025
M
Verified Purchase
Martha
Alexandria, US
★★★★★ 1
No se usó, llego incompleto
Size: 88''W-4 Panel, Color: Beige
Lo devolví, llego incompleto
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 11, 2026
R
Verified Purchase
raggmopp
Waukegan, US
★★★★★ 5
Great quality, very versatile
Size: 6 Panel-132‘’Wide, Color: Beige, Size: 6 Panel-132‘’Wide, Color: Beige
I'm very pleased with this item. It was not complicated to assemble but some items required dexterity and strength. The fabric panels are nice and tight and that's partly why it's a little hard to get that final screw in. I'm very pleased with the legs and the wheels. The metal components are nicely finished and feel substantial and endurable. I can easily fold this so many different ways… I can minimize the number of panels that are seen if desired and it can be straight or accordion. It's very stable which was hugely important to me because I'm fostering many many cats. It's not cheap looking and the light color fabric allows enough light to pass through that it doesn't darken the room substantially. I think the price was very reasonable
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 7, 2026
S
Verified Purchase
Steven Chandler
Louisville, US
★★★★★ 5
Affordable. And Good!
Size: 4 Panel-88‘’Wide, Color: Black
We use it everyday. All the pieces came and it was very easy to put up. High quality fabric, and easy to move around.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 21, 2026

recommand products