SKU: 91824610714

CD7 Ligand/SECTM1 His Tag Protein, Human

Sale price$226.80 Regular price$252.00
Save 10%

Pay in installments of $63.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 22 - Aug 27

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

CD7 Ligand/SECTM1 His Tag Protein, HumanProduct Specification Species Human Antigen CD7 Ligand Synonyms CD7 Ligand, SECTM1, K12 Accession Q8WVN6 Amino Acid Sequence Gln29 Gly145, with C terminal 8*His QNEGWDSPICTEGVVSVSWGENTVMSCNISNAFSHVNIKLRAHGQESAIFNEVAPGYFSRDGWQLQVQGGVAQLVIKGARDSHAGLYMWHLVGHQRNNRQVTLEVSGAEPQSAPDTGGGGSHHHHHHHH Expression System HEK293 Molecular Weight 17 22kDa Purity >95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized

Product Specification


Species Human
Antigen CD7 Ligand
Synonyms CD7 Ligand, SECTM1, K12
Accession Q8WVN6
Amino Acid Sequence

Gln29-Gly145, with C-terminal 8*His QNEGWDSPICTEGVVSVSWGENTVMSCNISNAFSHVNIKLRAHGQESAIFNEVAPGYFSRDGWQLQVQGGVAQLVIKGARDSHAGLYMWHLVGHQRNNRQVTLEVSGAEPQSAPDTGGGGSHHHHHHHH

Expression System HEK293
Molecular Weight 17-22kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Lyman S D. et al. (2000) Identification of CD7 as a cognate of the human K12 (SECTM1) protein. J Biol Chem. 275(5): 3431-3437.

2、Lam G K. et al. (2005) Expression of the CD7 ligand K-12 in human thymic epithelial cells: regulation by IFN-gamma. J Clin Immunol. 25(1): 41-49.

Background

SECTM1 (secreted and transmembrane 1), also called K12, is either found as an approximately 27 kDa intracellular type I transmembrane protein that shows a perinuclear, Golgi‑like staining pattern, or as a 20 kDa soluble, secreted form. SECTM1 is expressed on thymic epithelial and fibroblast cells, breast cancer and leukemia cell lines, and neutrophils but not in peripheral lymphocytes. SECTM1 is expressed on cytomembrane, which is identified as a CD7 ligand.CD7 is expressed in T and natural killer (NK) cells, which could be activated by its ligand SECTM1, thus promoting the proliferation of T and NK cells. SECTM1 strongly costimulates CD4 and CD8 T cell proliferation and induces IFN-γ production, likely via a CD7-dependent mechanism. In addition, SECTM1 synergizes with suboptimal anti-CD28 to strongly augment T cell functions. A robust induction of IL-2 production when SECTM1 and anti-CD28 signals were present with TCR ligation.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 91824610714

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 12 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
I
Verified Purchase
Iowa Mama
Los Angeles, US
★★★★★ 4
This was a Good gift for the right person
Format: Paperback
My nephew wanted a similar book- this had better reviews and I heard about lots of things that he’d done with this book. Glad I got it
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 27, 2025
I
Ian
Lexington, US
★★★★★ 5
From the creator of the Godot Recipes site!
Format: Paperback
Absolutely loved this, takes you through building 5 different games from start to finish, and explains not only how to do things, but it also explains the why! Throughout the course of making these 5 games, you also get introduced to many of the Nodes within Godot, explanations on how they are used, and gives you some experience using them! Feels good to add more tools into your toolkit as you become more familiar and comfortable using more Nodes. Even though this book is not intended for beginners, I would still recommend this book. It comes with a link where you can download example files and get going with minimal effort, however to get the most out of the book I would try to recreate stuff yourself. I found it very useful for easing myself into trying out 3D development. I've been doing 2D for years, and am currently developing a 2D game in Godot, once I complete that I'll be diving headfirst into 3D and this book gave me a lot of insight, and I feel much better about the whole process.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 12, 2023
M
Verified Purchase
Momx4
Carnegie, US
★★★★★ 5
Just what a gamer needs!
Format: Paperback
Perfect gift for my son!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 26, 2015
M
Mick Charles Beaver
Lexington, US
★★★★★ 2
would have been better as a blog
Format: Paperback
First off, I have read over half of this book, but ultimately decided to put it down because it had a low signal-to-noise ratio. If the second half is filled with magic, I apologize in advance. What I liked: * The author is very honest. He does not shy away from discussing his failures (and successes). * The postmortem on the game "Life of Pixel" was especially good. * Interviews from various indie studios are sprinkled throughout. What I did not like: * A number of pieces of information were already out-of-date. This makes me think that the concepts should have been discussed at a higher level. For example, specifics about game engine costs are discussed. These numbers have changed since E3 of this year. Definitely recheck any information before formulating a plan based on the book's recommendations. * The indie studio interviews are a wasted opportunity in that they each interview has the same set of questions. It's like a questionnaire was sent out via email and the responses were pasted into the book. * When discussing commercial options, such as engines or other software packages, blurbs once again appear to be cut-and-pasted (this time verbatim from the package's web site). * Some of the advice is too broad and too light. For example, when writing about how to create a press release, the author discuss how to write in the active voice. I'm frankly not looking for writing tips in my Indie Game Developer Handbook. * The book is filled with tons of web links. My paperback copy was not so useful here. I ultimately left the book with the impression that the information would have been much better in the form of a blog. The author could have really gone in depth with the parts of the book that shined while keeping the surveys of topics in a form that serves them better (i.e. web links on the web).
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 28, 2015
M
Verified Purchase
Meridian
Lowell, US
★★★★★ 5
Helpful information and Questions to consider
Format: Paperback
As a writer of science fiction and fantasy I had already looked into the physical aspects of the worlds I was creating, but I quickly realized I needed to include society and culture in the worldbuilding. I started a search for information, questionairres, or guidelines to use and found very little that would be helpful to me as a writer. Until I came across this book. It's exactly what I needed. It touches on multiple aspects of beliefs and practices and asks questions to help you think through what you want for your worlds, even if it's mostly backgroud. A very useful tool.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 26, 2024

recommand products