SKU: 43358953760

Human Calprotectin(S100A8), His tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 1 - Sep 6

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human Calprotectin(S100A8), His tagProduct Specification Species Human Synonyms Calgranulin A; Calprotectin L1L subunit; Cystic fibrosis antigen (CFAG); Leukocyte L1 complex light chain; Migration inhibitory factor related protein 8 (MRP 8; p8); Urinary stone protein band A; CAGA Accession P05109 Amino Acid Sequence Protein sequence(P05109, Met1 Glu93, with C 10*His) MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKEGGGGSHHHHHHHHHH Expression

Product Specification


Species Human
Synonyms Calgranulin-A; Calprotectin L1L subunit; Cystic fibrosis antigen (CFAG); Leukocyte L1 complex light chain; Migration inhibitory factor-related protein 8 (MRP-8; p8); Urinary stone protein band A; CAGA
Accession P05109
Amino Acid Sequence

Protein sequence(P05109, Met1-Glu93, with C-10*His)
MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKEGGGGSHHHHHHHHHH

Expression System E.coli
Molecular Weight Predicted MW: 12.5 kDa Observed MW: 13.0 kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

S100A8 is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in the inhibition of casein kinase and as a cytokine. Altered expression of this protein is associated with the disease cystic fibrosis and post COVID-19 condition.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 43358953760

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 18 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
Junta151
Grantham, US
★★★★★ 5
Great sunscreen, easy to use and absorbs well
I would recommend this product because it's super easy to apply and doesn't leave a greasy feeling. The SPF 50 gives good sun protection, and it feels lightweight on my face. Plus, it's hydrating thanks to the hyaluronic acid. Definitely a good choice for daily use, and I like that it doesn't clog pores.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 2, 2025
P
Verified Purchase
Pet Lover
Natrona Heights, US
★★★★★ 5
Great Facial Sunscreen
Great sunscreen with moistuizer so no need to apply a second product. Keeps face feeling hydrated while protected.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 10, 2026
T
Verified Purchase
Tansu
Battle Creek, US
★★★★★ 5
Clear face
I love using Eucerin products. It’s safe my skin and protects. It’s my first time trying the sunscreen so far I like it. I don’t do makeups. It has a clear view on my face, doesn’t leave any whit spot le so I love it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 20, 2026
M
Verified Purchase
Melody Recktenwald
Belleville, US
★★★★★ 5
Best face sun protection
My Neutrogena one stung my eyes and made me constantly tear and this is soooo much better. It feels light and dries down well without feeling greasy. Also it didn't make my skin react. A++
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 13, 2026
J
Verified Purchase
John
Draper, US
★★★★★ 4
Greasy but light
It's very lightweight and is definitely hydrating it's lightly greasy after its dry and it is not matte but has a dewy shine to it , I have tried many sunscreens and settled on this one as it just has a nicer feel to it and is easier to apply everyday, it goes on quickly and leaves no white streaks at all Its more watery than thick And does NOT peel whatsoever I Would definitely recommend this as a daily Face sunscreen if you not mind the shine it has to it. Its convenient Yet the bottle is small and last only about a 1 to 3 weeks depending how many times you use it To bad They DO NOT MAKE A BIGGER SIZE
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 25, 2026

recommand products