SKU: 46503601985

Human pro-GRP, His Tag

Sale price$166.50 Regular price$185.00
Save 10%

Pay in installments of $46.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 31 - Sep 5

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human pro-GRP, His TagProduct Specification Species Human Accession P07492 Amino Acid Sequence Protein sequence(P07492, Ser54 Asp121 with C 10*His) STGESSSVSERGSLKQQLREYIRWEEAARNLLGLIEAKENRNHQPPQPKALGNQQPSWDSEDSSNFKDGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Theoretical: 9. 4kDa Actual: 13kDa Purity 95% by SDS PAGE Endotoxin <1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized Powder Reconstitution Reconstitute no more than 0. 1 mg mL

Product Specification


Species Human
Accession P07492
Amino Acid Sequence

Protein sequence(P07492, Ser54-Asp121 with C-10*His)


STGESSSVSERGSLKQQLREYIRWEEAARNLLGLIEAKENRNHQPPQPKALGNQQPSWDSEDSSNFKDGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical: 9.4kDa Actual: 13kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Reconstitution Reconstitute no more than 0.1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 ℃ to -70 °C as supplied.

1 month, 2 to 8 °C under sterile conditions after reconstitution.  

Please avoid repeated freeze-thaw cycles. 

Background

Pro-Gastrin-Releasing-Peptide, also known as Pro-GRP, is a Gastrin-Releasing-Peptide (GRP) precursor, a neurotransmitter that belongs to the bombesine/neuromedin B family. GRP stimulates the secretion of gastrin in order to increase the acidity of the gastric acid. Pro-GRP is a peptide composed of 125 amino acids, expressed in the nervous system and digestive tract. In pathological situations, GRP has mitogenic activity in vitro in many tumors such as pancreatic, small cell lung (SCLC), prostate, kidney, breast and colorectal cancers. GRP could operate as an autocrine growth factor. In cancers, GRP induces cell growth and inhibits apoptosis by shutting down the endoplasmic reticulum stress pathway. As early as 1994, research on Pro-GRP as a biomarker for small cell lung cancer began. Because of the very short half-life of GRP (2 minutes), the Pro-GRP is used for measurements and analysis. Since then, Pro-GRP has been used as a tumor marker for patients with small cell lung cancer (SCLC) in limited and extended stages.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 46503601985

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 29 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
I
Verified Purchase
Ian
Cuba, US
★★★★★ 5
essential reading for activists and healers alike
Format: Paperback
as a white trauma therapist & somatic practitioner who in my early career worked primarily in Communities of Color, People of Color clients help me realize that I could not support them in healing the root of what they were dealing with if I did not understand the trauma of systemic and intergenerational racism. As an anti-racist educator, after co-facilitating many 2 day trainings and watching most people dissociate the whole time only come back around to repeating courses not remembering most of what we talked about, I was becoming disillusioned with both fields of practice. Resmaa Menakem's book came at just the right time in my journey, and I believe in our movement, to help us bridge the worlds of anti-racism and somatics and carve the path forward to heal our bodies and souls from white supremacy. White folks like myself will be tempted to breeze through this book and teach it to others; We would do well instead to form communities around the practices in here and integrate the deep healing available to us in both the history and somatics Resmaa offers us. This is truly one of our sacred movement texts on the path to Collective Liberation. For healers: This is the tool for healing the racism at the root of our trauma and disembodiment. For activists: This is the tool for healing the internalized racial oppression that busts up our movements. -- kelly germaine strickland, msw, lisw
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 16, 2020
D
Verified Purchase
Duane Banks
Cuba, US
★★★★★ 5
Great Read
Format: Paperback
Great Read
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 2, 2026
K
Verified Purchase
km
Los Angeles, US
★★★★★ 5
Awesome Book
Format: Hardcover
Our son-in-law loves anything aviation. This book is beautifully made. Large and full of history and fun information. We gave it to him for Christmas. he loves it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 15, 2025
S
Verified Purchase
Shoreline shopper
Carnegie, US
★★★★★ 5
Beautiful book with great pictures and historic notations
I bought this for my daughter who is a great plane enthusiast and makes regular trips to the Boeing Flight Museum in South Seattle. She visited this museum once and loves this book as a commemoration of that event.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 21, 2023
L
Verified Purchase
Lenny
Phoenix, US
★★★★★ 5
Made a great gift!
Format: Hardcover
Arrived early and in great condition! Made for a great gift!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 27, 2025

recommand products