SKU: 50602339356

Human Galectin-3, His tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 30 - Sep 4

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human Galectin-3, His tagProduct Specification Species Human Synonyms Gal 3, 35 kDa lectin, Carbohydrate binding protein 35 (CBP 35), Galactose specific lectin 3, Galactoside binding protein (GALBP), IgE binding protein, L 31, Laminin binding protein, Lectin L 29, Mac 2 antigen, LGALS3, MAC2 Accession P17931 Amino Acid Sequence Protein sequence(P17931, Met1 Ile250, with C 10*His)

Product Specification


Species Human
Synonyms Gal-3, 35 kDa lectin, Carbohydrate-binding protein 35 (CBP 35), Galactose-specific lectin 3, Galactoside-binding protein (GALBP), IgE-binding protein, L-31, Laminin-binding protein, Lectin L-29, Mac-2 antigen, LGALS3, MAC2
Accession P17931
Amino Acid Sequence

Protein sequence(P17931, Met1-Ile250, with C-10*His)
MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMIGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical:27.8kDa Actual:35kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Galectin-3 is a member of the lectin family, of which 14 mammalian galectins have been identified. Galectin-3 is approximately 30 kDa and, like all galectins, contains a carbohydrate-recognition-binding domain (CRD) of about 130 amino acids that enable the specific binding of β-galactosides. Galectin-3 (Gal-3) is also a member of the beta-galactoside-binding protein family that plays an important role in cell-cell adhesion, cell-matrix interactions, macrophage activation, angiogenesis, metastasis, apoptosis. Galectin-3 is increasingly being used as a diagnostic marker for different cancers. It can be screened for and used as a prognostic factor to predict the progression of the cancer. Galectin-3 has varying effects in different types of cancer. One approach to cancers with high galectin-3 expression is to inhibit galectin-3 to enhance treatment response.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 50602339356

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 11 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
C
Verified Purchase
Carolyn oehl
Lexington, US
★★★★★ 5
Love the style and Multi pockets!
Being a traveling float Phlebotomist for a very large company I need a bag that is extremely well-made holding my schedules.. my books, my PPE outfit, and all other essentials I need for my position. This bag is definitely the one very well-made, multi pockets more than enough room for everything that I need to carry all my equipment for me… to each job. Definitely would recommend this to anybody who travels in their job. Definitely purchased from this company again. Shipping was very fast and the product is in my eyes perfect.!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 1, 2026
D
Verified Purchase
daisy A
Los Angeles, US
★★★★★ 4
Spacious
Great material, easy to clean and repels water. I love the zipper to close the opening, carrys a lot and i love the large side pocket and 2 small pockets on ends great for keys for easy find
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 24, 2023
A
Verified Purchase
Amazon Customer
Louisville, US
★★★★★ 5
Perfect campus bag!!
Color: Leopard Spots
Used it as a school bag for college since I prefer shoulder bags over backpacks. Sturdy. Holds SO MUCH! Books, binders, School materials, food and snacks, giant water bottles....and CUTE asl!!! Got this in my last year of college. Wish I had found this bag sooner so I could have used it throughout all of my college years!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 9, 2025
J
Verified Purchase
Jenna
Phoenix, US
★★★★★ 5
Beautiful, sturdy and comfortable!
I am very satisfied with this bag! I honestly thought that because the price was so low that it would be more of a lightweight beach bag, however, it is very sturdy and holds so many things. The straps are very thick and comfortable. There are a few pockets inside zippered pockets of some side pockets and a front zipper pocket. I get so many compliments on this bag. Two of my friends actually bought the same bag! I honestly want to buy another one just in case somewhere down the road something ever happens to this one because I am obsessed with it. I use it every day for work is very easy to clean as well. It’s almost like a neoprene type of fabric so it wipes off very easily. I highly recommend this product.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 8, 2023
J
Verified Purchase
Jeanmarie N
Birmingham, US
★★★★★ 5
Good quality bag
Color: Black
Very sturdy construction. Big enough to hold a tablet and a book. I am happy with this pruchase
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 7, 2025

recommand products