SKU: 69786951811

CD7 His Tag Protein, Cynomolgus

Sale price$225.00 Regular price$250.00
Save 10%

Pay in installments of $62.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 24 - Aug 29

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

CD7 His Tag Protein, CynomolgusProduct Specification Species Cynomolgus Antigen CD7 Synonyms CD7, GP40, TP41, LEU 9, Tp40 Accession XP_005585387. 1 Amino Acid Sequence Ala26 Pro180, with C terminal 8*His AQEVQQSPHCTIAPVGGSVNITCSTSGELHGIYLRQLGPQPQNIIYYEDRVVPTTDKRFQGRIDFSGSQDNLTITMHHLQPSDTGTYTCQAVTEINVYGSGTLVLVTEEQSQGLHRCSDAPPTGSALPVPPTTSALPALPTASALPALPTASALPGGGSHHHHHHHH Expression System HEK293 Molecular Weight 35 40kDa (Reducing) Purity >95% by SDS PAGE Endotoxin <0. 1EU g

Product Specification


Species Cynomolgus
Antigen CD7
Synonyms CD7, GP40, TP41, LEU-9, Tp40
Accession XP_005585387.1
Amino Acid Sequence

Ala26-Pro180, with C-terminal 8*His

AQEVQQSPHCTIAPVGGSVNITCSTSGELHGIYLRQLGPQPQNIIYYEDRVVPTTDKRFQGRIDFSGSQDNLTITMHHLQPSDTGTYTCQAVTEINVYGSGTLVLVTEEQSQGLHRCSDAPPTGSALPVPPTTSALPALPTASALPALPTASALPGGGSHHHHHHHH

Expression System HEK293
Molecular Weight 35-40kDa (Reducing)
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Sempowski G D. et al. (1999) Resistance of CD7-deficient mice to lipopolysaccharide-induced shock syndromes. J Exp Med. 189(6): 1011-1016.

Background

CD7 is a 40-kD member of the Ig gene superfamily that is expressed on a major subset of human peripheral T lymphocytes and NK cells. CD7 is an early T cell activation antigen in that CD7 mRNA levels rise within 15 min after initiation of a transmembrane calcium ion flux. CD7 can complex with CD3 and CD45 molecules, and CD7 signaling involves both protein kinase C and protein tyrosine kinase. CD7 has been shown to be a functional signal-transducing molecule on resting NK cells. Antibody cross-linking of NK cell CD7 induced increases in free cytoplasmic calcium, secretion of IFN-γ, NK cell proliferation, adhesion to fibronectin, and NK cytotoxic activity. Although the above studies have demonstrated in vitro roles for CD7 in T and NK cell activation and/or adhesion, relevant functions of CD7 in vivo remain unknown.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 69786951811

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 16 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
F
Verified Purchase
Frances
Chelsea, US
★★★★★ 5
It did work
Size: 1-Pack (32 oz)
Sealed a small nail hole in a front tractor tire. Better than taking to shop for inside patch or making the 3x bigger for a rope patch.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 6, 2026
J
Verified Purchase
Jim
Pawtucket, US
★★★★★ 5
Fixed a Bead Sealing Issue
Size: 1-Gallon (128 oz)
For traction in snow, I recently installed new "agricultural" style lugged front tires on a Simplicity garden tractor from around 1980. The tractor looks like it's survived a war, evidently having had a hard life as a workhorse owned by a school district. The front rims are rusty, and I naively thought the beads of these thick tires would seal properly anyway. They didn't. The jug of sealant ships with a valve core removal tool. Removing and reinstalling the cores is a piece of cake if you've never done it. I pumped a generous amount of the product into each tire and then did a few fast laps in a grassy paddock. It's a Kohler 19HP twin and it's a bit of a rocket. 😎 One tire sealed, the other didn't, and there was still a faint hiss. I added more product to that side and repeated the process. It seemed to hold. The next day that side was flat again, so I added more sealant and this time it held. Based on this experience, I'd say that instead of strictly following what the instructions recommended as an amount per tire, keep adding product in increments until the tire holds air. It's good stuff and it works. Will the tire self-heal if I puncture it? I don't know yet. It saved me the headache of having to remount these small tires or install tubes.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 24, 2026
S
Verified Purchase
shimshong
Draper, US
★★★★★ 5
Stop wasting your money on green slime or Fix-A-Flat or any of the other tire sealant
Size: 1-Gallon (128 oz)
Flat out is by far the best product on the market to fix flat tires and prevent flat tires. This will be the second gallon jug that I purchased that stuff on everything. all of my landscape equipment has it in every tire. And to paint and even better picture for you I have a scag mower that is 20 years old The tires are probably 18 years old ugly as could be and would not hold air until I put the flat out in it it has been sitting now for over a year and every tire still has air That's how good the stuff is. Don't just buy one gallon by two cuz it will get used
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 11, 2025
A
Verified Purchase
Amazon Customer
Lowell, US
★★★★★ 5
John Deere 5x4 (gator)
Size: 4-Pack (128 oz), Size: 4-Pack (128 oz)
Excellent product. The John Deere 5x4 (Gator) in picture sat for ten years, the tires were flat, the front tire was the worse. To move this Gator from my neighbors place he had to load it on a trailer, he aired up the rear 4 tires but the front would air up and leak before he could move it. He put a make do wheel to get it moved to my place. shortly after unloading the rear 4 tires went flat. All were badly weathered. I read about a stop leak "FLATOUT" I ordered one bottle and put it in the front wheel and I aired it up, it held air for several hours. I called FLATOUT Support and told them I put 1/2 bottle in front tire and how it helped, He said it calls for a full bottle per tire so I added the rest of the FLATOUT. I bought four more bottles of FLATOUT and put those in all 4 tires, put air in and drove the unit a block. next day two tires were low so I finished putting FLATOUT in and aired the tires and drove two to three blocks. the weather snowed so I parked the Gator for two weeks, the tires never went flat. I checked the air pressure and had lost about 2-3 pounds, refilled with air and on a warm day drove the Gator about 2 miles. No flat tires. Note the front tire had a weathered crack 4 inches long where it sat folded for so many years and I saw where this product had sealed this leak and no air loss after two weeks of sitting.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 7, 2021
R
Verified Purchase
R. Arminio
Omaha, US
★★★★★ 5
Recommended
Works extremely well for tire patch repairs. Just be sure product is totally dry before applying patch on inner tube or interior of tubeless tire.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 25, 2026

recommand products