SKU: 57275905679

Human Collagen IV, His Tag

Sale price$99.00 Regular price$110.00
Save 10%

Pay in installments of $27.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 30 - Sep 4

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human Collagen IV, His TagProduct Specification Species Human Accession P02462 Amino Acid Sequence Protein sequence(P02462, Lys28 Lys172, with C 10*His) KGGCAGSGCGKCDCHGVKGQKGERGLPGLQGVIGFPGMQGPEGPQGPPGQKGDTGEPGLPGTKGTRGPPGASGYPGNPGLPGIPGQDGPPGPPGIPGCNGTKGERGPLGPPGLPGFAGNPGPPGLPGMKGDPGEILGHVPGMLLKGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight 28kDa Purity 95% by SDS PAGE Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized Powder Reconstitution

Product Specification


Species Human
Accession P02462
Amino Acid Sequence Protein sequence(P02462, Lys28-Lys172, with C-10*His) KGGCAGSGCGKCDCHGVKGQKGERGLPGLQGVIGFPGMQGPEGPQGPPGQKGDTGEPGLPGTKGTRGPPGASGYPGNPGLPGIPGQDGPPGPPGIPGCNGTKGERGPLGPPGLPGFAGNPGPPGLPGMKGDPGEILGHVPGMLLKGGGGSHHHHHHHHHH
Expression System HEK293
Molecular Weight 28kDa
Purity

>95% by SDS-PAGE

Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage
  • 12 months from date of receipt, -20 ℃ to -70 °C as supplied.
  • 1 month, 2 to 8 °C under sterile conditions after reconstitution.  
  • Please avoid repeated freeze-thaw cycles. 

Background

Collagen typte IV is a type of collagen found primarily in the basal lamina. Mutations to the genes coding for collagen IV lead to Alport syndrome. This will cause thinning and splitting of the glomerular basement membrane. It will present as isolated hematuria, sensorineural hearing loss, and ocular disturbances and is passed on genetically, usually in an X-linked manner. Liver fibrosis and cirrhosis are associated with the deposition of collagen IV in the liver. Serum Collagen IV concentrations correlate with hepatic tissue levels of collagen IV in sugjects with alcoholic liver disease and hepatitis C and fall following successful therapy.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 57275905679

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 11 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
R
RealDeal
Lake Worth, US
★★★★★ 5
Looks nice but it's not very stylish, works as intended, happy with purchase
Color: Black, Size: 4 Panel-88''
This 6 ft room divider is exactly what I needed and works great! It was very easy to set up and took only a few minutes to assemble. I was pleasantly surprised by how lightweight it is, and it folds up easily for storage when not in use. The fabric-style panels look nice and provide good privacy, and the included clips help keep everything neatly in place. It’s a simple but effective design that does what it’s supposed to do. Because it’s lightweight, it may need a bit of extra support depending on where you place it—I used small weights on the base, and that completely solved the stability issue. Overall, I’m very happy with this purchase. It’s practical, easy to use, and a great value for the price. I would definitely recommend it! Industrial
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 22, 2026
L
LSch01
Chelsea, US
★★★★★ 3
Assembly is harder than it should be; you get what you paid for
Color: Black, Size: 4 Panel-88''
Review of SUNALLY Room Divider 6FT Folding Privacy Screens, 4 Panel Fabric Divider for Room Separation, 88" W Freestanding Portable Wall Dividers Screen for Home Dorm Studio Office, Black I hate when I have to leave products a not so good review... Assembly is harder than it should be, mainly because there shouldn't BE any assembly. I have ordered several room divider privacy screens over the last couple of years and not one of them needed any kind of assembly. With that aside, it STILL was a pain in the sphincter to assemble. One of the "legs" just sits on top of a foot plate - it's not screwed in to anything. It's kind of flimsy and the base plates don't have anything on them to not scuff up the floor. With all that said, though, it does stand up and will block out what I need to block out. At the less-than-$50 price-point, it's kind of what should be expected. If I had purchased this outright, I would have considered sending it back and getting a higher quality. But if you only have $50 to spare and don't mind assembling things, it could be good for you.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 28, 2026
O
Ocean
Bozeman, US
★★★★★ 5
Great buy
Color: Black, Size: 4 Panel-88''
This room divider is exactly what I needed. When you have 2 kids sharing a room and don’t want to spend a lot of money to divide their space this is what you can use. Believe it or not they are much happier now. This came in a small box which scared me but once I was able to get this up I was very pleased. It was easy to put together. The fabric is pretty good quality, it’s stable and stands up fine. Good value and worth it to have peace and quiet in the house.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 18, 2026
B
Verified Purchase
Beth Lukes
Battle Creek, US
★★★★★ 1
Junk
Color: Black, Size: 4 Panel-88'', Color: Black, Size: 4 Panel-88''
Horrible. The parts are not right. It won’t fit together or disassemble and can’t return it like this. Parts won’t fit properly and missing holes for screws. Also, can’t get through to a person for any assistance. Picture shows the hole and then the lack of a hole where a screw belongs.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 13, 2026
E
Verified Purchase
Excelente
Boise, US
★★★★★ 5
Excelente calidad
Color: Black, Size: Standard - 4 Panel
Excelente
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 1, 2026

recommand products